KEGG   Nocardia farcinica: nfa46650Help
Entry
nfa46650          CDS       T00207                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
nfa  Nocardia farcinica
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:nfa00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:nfa00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
4864907..4865401
Genome map
AA seq 164 aa AA seqDB search
MAEMSIRDIPLRTLSGADTTLAELVGDKAVLLVNVASKCGLTPQYSGLVELHRSYGERGF
SVVGVPCNQFMGQEPGTAEEIEQFCSTTYGVDFPLLEKTEVNGENRHPLYAELTQVADAE
GTAGDIQWNFEKFLIDRDGKVAGRFRPRTEPQDPALVAALEGVL
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
gtggccgaaatgagcattcgcgacatcccgctgcgtaccctctccggcgcggacaccacc
ctggccgagctggtcggcgacaaggcggtgctgctggtcaacgtcgcctcgaaatgcggt
ctgacgccgcagtattccggcctggtcgagctgcaccgcagctacggcgagcgcggtttc
agcgtggtcggcgtgccgtgcaaccagttcatgggccaggagccgggcacggccgaggag
atcgagcagttctgctcgaccacctacggcgtggacttcccgctgctggagaagaccgag
gtcaacggcgagaaccggcacccgctctacgcggagctgacccaggtcgccgacgccgag
ggcaccgcgggcgacatccagtggaacttcgagaagttcctcatcgaccgcgacggcaag
gtggcgggccggttccggccgcgcaccgaaccgcaggacccggcgctcgtcgcggccctc
gaaggggtgttgtag

DBGET integrated database retrieval system