KEGG   Nocardia farcinica: nfa47410Help
Entry
nfa47410          CDS       T00207                                 

Gene name
dapE
Definition
(RefSeq) succinyl-diaminopimelate desuccinylase
  KO
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
nfa  Nocardia farcinica
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:nfa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    nfa47410 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    nfa47410 (dapE)
Enzymes [BR:nfa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     nfa47410 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
complement(4951983..4953083)
Genome map
AA seq 366 aa AA seqDB search
MTIDLSADPIALTAALVDIPSVSLDERAIADVVERALREQTTGFEVLRHGNVVLARTRRG
LPTRVILAGHLDTVPIADNVPSRFGTGPDGEQLLHGCGTVDMKSGDAVFLHLAATVTDPV
HDLTLIFYDGEEIAAEYNGLGHIERDLPEWLDGDLAVLGEPSGGWIEAGCQGTLRVRLRT
AGVRAHSARAWMGDNAIHRLAPVLARLADYRARQVDIDGCVYREGLSAVAVRGGVAGNVI
PDVGEVDVNFRFAPDRDLDQAIAHVREVFAGLEVEFEVTDAAPGALPGLTAPAAKALVES
VNAHGGGGVRAKYGWTDVSRFAARGIPAVNFGPGDPNLAHKRDEHVPTAQITAVTAMLRA
YLTGAV
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatcgacctgtccgccgatcccatcgccctcaccgccgccctcgtcgacatcccc
agcgtctcactggacgagcgcgcgatcgcggatgtcgtggaacgggcgctgcgtgagcag
accaccgggttcgaggtgctgcggcacggcaacgtcgtgctcgcccgcacccggcgcggc
ctgccgacccgggtgatcctggccgggcacctggacaccgtgccgatcgccgacaacgtg
ccgagccgcttcggcaccggccccgacggcgagcagctgctgcacggctgcggcaccgtc
gacatgaagtccggcgacgcggtgttcctgcacctggccgcgacggtgaccgaccccgtg
cacgacctcaccttgatcttctacgacggcgaggagatcgccgccgagtacaacggcctc
ggccacatcgaacgcgacctgcccgaatggctcgacggcgacctggccgtgctcggcgaa
ccctccggcggctggatcgaggcgggctgccagggcacgctgcgggtgcggctgcgcacc
gcgggcgtgcgggcgcattcggcacgggcctggatgggtgacaacgcgatccaccggctg
gcgccggtgctggcgcggctggccgactaccgagccaggcaggtcgacatcgacggctgc
gtgtaccgcgaaggcctgtccgcggtggcggtgcgcggcggggtggccggcaacgtgatc
cccgatgtcggtgaggtggacgtcaacttccgcttcgcccccgaccgtgacctggaccag
gcgatcgcccacgtgcgcgaggtgttcgccgggctggaggtggagttcgaggtgaccgac
gccgcaccgggcgcgctgcccggcctcaccgcgccggcggccaaggcgctcgtcgagtcg
gtgaacgcgcacggcggcggtggggtgcgggccaagtacggctggaccgacgtgtcgcgc
ttcgccgcccgcggcatccccgcggtgaacttcggtccgggcgatccgaacctggcccac
aagcgcgacgagcacgtgccgaccgcgcagatcaccgcggtcaccgcgatgctgcgcgcc
tacctcaccggcgcggtctga

DBGET integrated database retrieval system