KEGG   Nocardia farcinica: nfa48080Help
Entry
nfa48080          CDS       T00207                                 

Definition
hypothetical protein
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
nfa  Nocardia farcinica
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nfa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    nfa48080
Enzymes [BR:nfa01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     nfa48080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
5023127..5023546
Genome map
AA seq 139 aa AA seqDB search
MSEEVELRQDAVTTVREFFAAMELGAVGEALELLDPQVVWKNTSLPDLRGARAHAVLRGL
NRPWVGFAAEMHHIAADGDVVLTDRTDILRFGPVRIAFWVMGTFELRDGRIVLWHDHFSW
ENVLRGTAVGLVRALLPRR
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaagaagtcgaactgcggcaggacgcggtcaccacggtgcgcgagttcttcgcg
gcgatggagctgggcgcggtgggtgaggcgctggagctgctggatccgcaggtggtgtgg
aagaacacctcgttgccggatctgcggggggcgcgggcgcacgcggtgttgcgcgggctg
aaccggccctgggtcgggttcgcggccgagatgcaccacatcgccgccgacggggacgtg
gtgctcaccgatcgcaccgacatcctccggttcgggccggtgcggatcgcgttctgggtg
atgggcaccttcgaactgcgcgacggccgaatcgtgctgtggcacgaccacttcagctgg
gagaacgtcctgcgcggcacggccgtgggcctggtccgcgcgctgctgccgcgacgctga

DBGET integrated database retrieval system