KEGG   Nocardia farcinica: nfa51890Help
Entry
nfa51890          CDS       T00207                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
nfa  Nocardia farcinica
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    nfa51890 (gpmA)
   01230 Biosynthesis of amino acids
    nfa51890 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    nfa51890 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    nfa51890 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    nfa51890 (gpmA)
Enzymes [BR:nfa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     nfa51890 (gpmA)
Exosome [BR:nfa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   nfa51890 (gpmA)
  Exosomal proteins of melanoma cells
   nfa51890 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
complement(5487787..5488524)
Genome map
AA seq 245 aa AA seqDB search
MTYTLVLLRHGESEWNALNLFTGWVDVHLTDKGVAEGKRAGELLAEHGILPDIVYTSLLR
RAISTANIALDAADRHWIPVVRDWRLNERHYGELQGKNKAQIRDKYGEEQFMLWRRSYDT
PPPPIEAGNEYSQEGDARYAGIDIPKTECLLDVVNRMVPYWESTISKDLLAGKTVLIAAH
GNSLRALVKHLDQISDEEIAGLNIPTGIPLRYELDENLRPVRPREYLDPEAAAAGAAAVA
SQGGK
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgacgtacaccctcgtgctgctgcgccacggcgagagcgaatggaacgccctgaacctg
ttcaccggctgggtggacgtgcacctcaccgacaagggcgtggccgagggcaagcgggcc
ggtgagctgctcgccgagcacgggatcctgcccgacatcgtctacacctcgctgctgcgc
cgggccatctccaccgccaacatcgccctcgacgccgccgaccggcactggatcccggtc
gtgcgggactggcggctcaacgagcggcactacggcgagctgcagggcaagaacaaggcc
cagatccgcgacaagtacggcgaggagcagttcatgctgtggcggcgcagctacgacacc
ccgccgccgcccatcgaggcgggcaacgagtacagccaggagggcgacgcccgttacgcg
ggcatcgacatccccaagaccgagtgcctgctcgacgtggtgaaccggatggtcccctac
tgggagtcgaccatctccaaggatctgctggcgggcaagaccgtgctgatcgccgcgcac
ggcaactcgctgcgcgcgctggtcaagcacctcgaccagatctccgacgaggagatcgcc
ggtctgaacatcccgaccggcattccgctgcgctacgaactggacgagaacctgcgtccg
gtgcgcccccgcgagtacctggacccggaggcggccgccgccggcgcggccgcggtcgcg
agccagggcggtaagtaa

DBGET integrated database retrieval system