KEGG   Nocardia farcinica: nfa9480Help
Entry
nfa9480           CDS       T00207                                 

Gene name
sdhD
Definition
(RefSeq) succinate dehydrogenase membrane subunit
  KO
K00242  
succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
nfa  Nocardia farcinica
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    nfa9480 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    nfa9480 (sdhD)
   00650 Butanoate metabolism
    nfa9480 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    nfa9480 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
complement(1050621..1051052)
Genome map
AA seq 143 aa AA seqDB search
MTAPVLGKSYDRPASLDLPRAPRGRAGNNFEKYAWLFMRFSGLLLIVLVLGHMFIMLMID
GGVQRLNFAFVAGRWASPFWQIWDLTMLWLAQLHGGNGLRTVIDDYSRKDSTRFWLKTLL
AVSMILIMGVGTYVIFTFDPNIS
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacctgttctcggcaagtcctacgaccgccccgccagcctggacctgccccgg
gcgccgcgcgggcgcgcgggcaacaacttcgagaagtacgcctggctgttcatgcgcttc
tccgggctgctgctgatcgtgctcgtcctgggccacatgttcatcatgctgatgatcgac
ggcggcgtgcagcgcctgaacttcgcgttcgtggccggccgctgggcctcgccgttctgg
cagatctgggatctcaccatgctctggctggcccagctgcacggcggcaacggcctgcgc
accgtgatcgacgactactcccgcaaggactcgacccgcttctggctcaagaccctgctc
gcggtctcgatgatcctgatcatgggcgtcggcacctacgtcatcttcaccttcgacccc
aacatcagttag

DBGET integrated database retrieval system