KEGG   Nocardia farcinica: nfa9510Help
Entry
nfa9510           CDS       T00207                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
nfa  Nocardia farcinica
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    nfa9510 (deoA)
Enzymes [BR:nfa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     nfa9510 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
1052167..1053450
Genome map
AA seq 427 aa AA seqDB search
MTALDAVSLITTKRDGGQLSDEQIDWVIDAFTRGAVADEQMAALAMAILLRGMTRRETAR
WTAAMIASGQRMDFTDLPRPTVDKHSTGGVGDKITLPLAPLVAACGAAVPQLSGRGLGHT
GGTLDKLESIPGWRADVPVARMREILADPAIGAVICAAGADLAPADKRLYALRDVTGTVE
SVPLIASSIMSKKIAEGTAALVLDVKVGSGAFMKDRATATELATTMVELGADAGVRTVAL
LTAMDSPLGRTAGNALEVAEAVAVLAGGGPADVVELTLALAREMVALAGLDTDPADVLAS
GRAMDHWRAMVRAQGGDPDAPLPRATHTEILRADRDGVLTRLDAMGVGVAAWRLGAGRAR
QGDPVQHGAGVALHAGVGDRVTAGQALCTLHTDTPEAFDSAAAALREGIEIGDAAAGTGP
LVLDRIG
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgacggctctggacgcggtttccctcatcaccaccaaacgcgacggcggacagctctcc
gacgagcagatcgactgggtgatcgacgccttcacccggggcgcggtcgccgacgaacag
atggcggcgctggcgatggcgatcctgctgcgcgggatgaccaggcgcgagaccgcccgc
tggaccgccgccatgatcgcctccgggcagcgcatggacttcaccgacctgccccggccc
accgtcgacaagcactccaccggcggcgtcggcgacaagatcaccctgccgctggcgcca
ctggtcgccgcctgcggcgcggcggtgccgcagctgtccggccgcgggctcgggcacacc
ggcggcaccctggacaaactcgagtcgatcccgggctggcgggccgacgtcccggtggcg
cggatgcgcgagatcctggccgacccggcgatcggtgcggtgatctgcgcggccggcgcc
gacctcgctcccgccgacaagcgcctctacgcactgcgcgacgtcaccggcaccgtcgag
tcggtgccgctgatcgccagttcgatcatgagcaagaagatcgccgagggcaccgccgcg
ctggtcctcgacgtcaaggtcggctccggcgcgttcatgaaggaccgcgcgaccgcgacc
gaattggccaccacgatggtcgagctcggcgccgacgcgggcgtgcggacggtggccttg
ctgaccgcgatggacagcccgctcggccgcacggcgggcaatgcgctcgaggtcgccgag
gcggtcgcggtcctggccggtggcggccccgccgacgtcgtcgagctgaccctggcactg
gcgcgcgagatggtcgccctcgccggcctggacaccgatccggccgacgtgctcgcctcc
ggccgcgcgatggaccactggcgcgcgatggtgcgcgcccagggcggcgacccggacgcg
ccgctgccgcgcgccacccacaccgagatcctgcgcgccgaccgtgacggcgtactgacc
cgcctcgacgcgatgggcgtcggtgtggccgcctggcggctcggcgcggggcgggcacgc
cagggcgacccggtgcagcacggcgcgggcgtggcactgcatgccggggtcggcgaccgc
gtcaccgctggccaggcgctgtgcaccctgcacaccgacacccccgaggcgttcgactcc
gcggccgccgcgctgcgcgaggggatcgagatcggcgacgccgccgccggcacgggcccg
ctcgtgctcgaccggatcggttga

DBGET integrated database retrieval system