KEGG   Nocardia farcinica: nfa9710Help
Entry
nfa9710           CDS       T00207                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
nfa  Nocardia farcinica
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:nfa00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
complement(1071753..1073252)
Genome map
AA seq 499 aa AA seqDB search
MRRYVAALDQGTTSTRCIVFDHGGRVLGLAQREHEQIFPRPGWVEHDAETIWRNTELVLA
EAMRTLELSAADIAAVGITNQRETTLVWERATGKPIHHAIVWQDTRTDRLVGELGGAQGP
TRYQDRTGLPLSTYFAGPKLRWILDHVPDARERAEAGELCFGTMDSWLLWNLTGAHITDV
TNASRTMLMDLRTQRWDEDICADFGVPPAMLPEIRSSSEVYGEITAGPLAGVAVAGILGD
QQAATFGQACLSPGEAKNTYGTGNFMLLNTGTTPVFSKHGLLTTVCYRLDDQPAVYALEG
SIAVTGSLVQWLRDNLGLISSADEIEPLARSVDDNGGAYIVPAFSGLFAPRWRPDARGVI
AGLTRFVTKAHLARAVLESTAFQTREVVDAMRADAESQQLDLELTTLKVDGGMTANDLLM
QFQSDILDVPVVRPVVAETTALGAAYAAGLAVGYWSGTDDIRANWAADTTWRPTMSDQDR
ATHLAAWNKAVERTYNWTA
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgctatgtggccgccctcgatcaaggcacgacctcgaccaggtgcatcgtcttc
gaccacggcggtcgcgtgctcggcctggcccagcgcgagcacgagcagatcttcccgcgc
ccgggctgggtggagcacgacgcggaaaccatctggcgcaacaccgaactcgtcctcgcc
gaggcgatgcggaccctcgagctgagcgccgccgacatcgccgccgtcggcatcaccaat
cagcgcgagaccacgctggtctgggagcgcgccaccggcaagcccatccaccacgccatc
gtctggcaggacacccgcaccgaccgcctcgtcggcgaactcggcggcgcgcaggggccg
acccgctaccaggaccggaccggcctgccgctgtccacctacttcgccggacccaagctg
cgctggatcctcgaccacgtcccggatgcgcgggagcgcgcggaggccggggaattgtgc
ttcggcacgatggacagctggctgctgtggaacctcaccggcgcacacatcaccgacgtc
accaacgcctcgcgcaccatgctcatggatctgcgcacccagcggtgggacgaggacatc
tgcgccgacttcggggtgcccccggccatgctgccggagatccgcagctcctcggaggtc
tacggcgagatcaccgcgggcccgctggccggtgtcgcggtggcgggcatcctcggtgac
cagcaggccgccaccttcggccaggcctgcctgtcgcccggtgaggccaagaacacctac
ggcaccggcaatttcatgctcctcaacaccgggaccacgccggtcttcagcaaacacggc
ctgctcaccacggtgtgctaccggctcgacgaccagcccgccgtctacgccctggagggc
tcgatcgccgtcaccgggtcgctggtgcagtggctgcgtgacaacctcggcctgatctcc
tccgccgacgagatcgaaccgctcgcgcgcagtgtcgacgacaacggcggcgcctacatc
gtgcccgccttctccggcctgttcgccccgcgctggcgtccggacgcgcgcggggtgatc
gcgggcctcacccggttcgtcaccaaggcgcacctggcccgcgcggtgctcgaatccacc
gccttccagacccgcgaggtggtcgacgccatgcgcgccgacgccgaatcccagcagctc
gacctggaattgacgacgttgaaggtggacggcggcatgacggccaacgatctgctcatg
cagttccagtccgacatcctcgacgtgccggtggtgcgcccggtggtcgccgaaaccacc
gcgctcggcgccgcctacgccgccggcctcgccgtcggctactggtcgggcaccgacgac
atccgcgccaactgggccgccgacaccacctggcgcccgacgatgagcgaccaggaccgc
gccacccacctggccgcctggaacaaggcggtggaacgcacctacaactggaccgcctga

DBGET integrated database retrieval system