KEGG   Nocardia farcinica: pnf11580Help
Entry
pnf11580          CDS       T00207                                 

Definition
cytochrome P450 monooxygenase
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
nfa  Nocardia farcinica
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nfa00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    pnf11580
  Amino acid metabolism
   00380 Tryptophan metabolism
    pnf11580
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    pnf11580
Enzymes [BR:nfa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     pnf11580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NIH_Japan: 
UniProt: 
Position
pNF1:177679..179100
Genome map
AA seq 473 aa AA seqDB search
MAVTTSTTSGGHSNPPLPHPKWRLPIINDLLTINPIKPTLTSLRDAEQLGGIFERRLVDW
PMIVVSDSELITEICDERNWAKHLGVPLRKMRHIARDGLFTARNDEPNWAKAHAVLAPAF
TKEAMRSYHQTMLTTIGELLDYWAKRDGQWVDVGEDMNKLTLEIIARTGFDYTFDSFTRS
EVHPFVAAMLRGLTYISRNSNMPPFLQKTIGARAAARHSRDITYVRTVVDDVIKARQASG
TVGDHHDLLDRMLTVPDPASDELLDTTNVRSQILTMLVAGHETSAGVLAFALYELSRRPE
LVAAARAEIETRFADGDLSTIAYDDVAKLRTLRRIVDETLRLYPVAPGFFREARHETTIG
GGRYRFGPGDWVLVLTLHAHRDPATWGPDAGEFQPDRWLPERMRSLDGRQVFKPFGTGLR
ACIGRQFAYHEIVLALAHILHTFEFTPDPGYELDIAEQITLKPHRFRLRLNHR
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgacaacttccaccacctcgggtggccactccaatccgccgttgccccacccg
aaatggcggctgccgatcatcaacgacctactcaccatcaaccccatcaagcccaccctc
acttcgctgcgggacgccgagcaactcggcggcatcttcgaacggcgcctcgtcgactgg
cccatgatcgtcgtctccgactccgaactcatcaccgagatctgcgacgagcgcaactgg
gccaaacacctcggcgtcccgctccggaagatgcgccacatcgctcgtgacggcctgttc
accgcccgcaacgatgaaccgaactgggccaaagcccacgctgtcctcgcgccagccttc
accaaggaggcgatgcgctcctaccaccagaccatgctcaccacgatcggcgaactcctc
gattactgggcgaagcgcgatggccagtgggtcgacgtcggcgaggacatgaacaaactc
accctcgagatcatcgcccgaaccggattcgactacaccttcgacagcttcacacgcagc
gaggtacacccctttgtcgccgccatgctgcgcggactgacctacatctcccgcaacagc
aacatgccgcccttcttgcagaagaccatcggcgcccgcgcggccgcacggcatagccgc
gacatcacctacgtccgaacggtcgtcgacgacgtcatcaaagcccgccaagccagcggc
accgtaggcgaccaccacgacctgctcgaccggatgctcaccgtgcccgacccggcttcc
gacgagctcctcgacaccacgaatgtccgcagccagatcctcaccatgctcgtcgcgggc
cacgaaaccagcgcgggagtcctcgctttcgcgctctacgagctcagccgccgccctgaa
ctcgtcgctgccgcccgcgccgagatcgagacacgcttcgccgacggcgacctatccaca
atcgcctacgacgacgtggcgaaacttcgaaccctacgccgaatcgtcgacgaaacgttg
cgcctctacccggtcgcgcccggcttcttccgtgaagcccggcacgagaccacgattggc
ggcgggcgctaccggttcgggcccggcgactgggtactcgtgctcacactgcacgcccac
cgcgaccccgccacgtggggccccgacgccggcgagttccagcccgaccgctggctgccc
gaacgaatgcgctctctggacggacgtcaggtattcaagccgttcggcaccgggcttcgc
gcctgcatcggtcgccaattcgcctaccacgagatcgttctcgcgctggcgcacatcctg
cacacattcgagttcacccccgatccagggtacgaactcgacatcgctgagcagatcacc
ctcaagccgcaccggttcaggctgcgactcaaccaccgctga

DBGET integrated database retrieval system