KEGG   Neosartorya fischeri: NFIA_001010Help
Entry
NFIA_001010       CDS       T01070                                 

Definition
glycosyl hydrolases family 11 protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
nfi  Neosartorya fischeri
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 330 aa AA seqDB search
MISFSSLSFGLAAIASAYALPGDKSVNLAERQTITSSQTGTNNGYYYSFWTNGAGTVQYT
NGAGGEYSVTWANQNGGDFTCGKGWNPGSDHDITFSGNFNPSGNAYLSVYGWTTSPLVEY
YILENYGSYNPGSSMTHKGTVTSDGSTYDIYEHQQVNQPSIVGTATFNQYWSIRQNKRSS
GTVTTANHFKAWASLGMNLGTHNYQIVSTEGYESSGTSTITVSSGGSSSGGSGGSSSTTS
SGSSPTGGSGSVSLLPHGCDFIVLLCGANAVESAGLALLAALRALARLQTRTTPSACSTF
LQGYIQVMDTSEYMRWISRLEILAFPLSQI
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgatctccttttcctcgcttagctttggactcgccgctatcgccagcgcatatgctctt
ccgggtgacaagtctgtcaacttagcggaacgtcagaccatcacgtccagccagacaggc
actaacaacggctactattattccttctggaccaacggtgccggaacagtgcaatacacg
aacggcgctggcggcgaatatagcgtgacctgggcgaatcagaacggtggtgactttacc
tgtgggaagggctggaatcctggcagtgaccatgacattaccttctctggcaactttaat
ccttccggaaatgcttatctctccgtgtatggatggactaccagccccctagtcgaatac
tacatcctcgagaactatggcagctacaatccaggctcgagcatgacgcacaagggcact
gtcaccagcgacggatccacctacgacatctatgagcaccaacaggtcaaccagccttcg
atcgtcggcacggccaccttcaaccagtactggtccatccgccaaaacaagcggtccagt
ggcacggtcaccaccgcgaatcacttcaaggcctgggctagtctggggatgaacctgggt
acccataactatcagatcgtttccactgagggatatgagagcagcggtacctcgaccatc
actgtctcgtctggtggttcttcttccggcggaagcggcggtagctcgtctactacttcc
tcgggcagctcccctactggtggctccggcagtgtaagtcttcttccacatggctgtgac
ttcattgttctgctttgtggggccaatgcggtggaatcggctggtctggccctacttgct
gctcttcgggcacttgcaaggcttcaaactcgtactactcccagtgcttgtagcaccttc
ttgcagggttatatccaagttatggacacatctgaatatatgcgatggatttcaagattg
gagatcctggcgttcccactgtctcagatatag

DBGET integrated database retrieval system