KEGG   Neosartorya fischeri: NFIA_001210Help
Entry
NFIA_001210       CDS       T01070                                 

Definition
glucan 1,4-alpha-glucosidase, putative
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
nfi  Neosartorya fischeri
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NFIA_001210
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     NFIA_001210
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 620 aa AA seqDB search
MRFASIVVGIASVLGHLATPSPAKELAARSPAAANSYLVKEGLFAYESILAALGNTGSNA
PGTAAGLLIASPTTQNPDYFFTWTRDAALTFKGLVDIFIAGNTFIGVNFDALETHIQDYI
SSQAVLQNVSNPSGRLSDGSGLGEPKFEVNFNPYSGGWGRPQRDGPALRAIAMLTYMRHL
IQQGKQSVASNLIWPVVANDLTYVAQYWNHTGFDLWEEVDGSSFFTTAVQHRAMVEGSVI
AKALGKPHAAYDAVAPEILCFLQSYWNGSAIVSNINVNNGRSGIDLNSVLTSIHTFDPAA
GCDDSTFQPCSSKALANHKVYVDSFRSIYGINAGLGPGKAANVGRYPEDVYQGGNPWYLA
TLAAAEQLYDALYQWKKQGYLTITQTSLAFFRDFSSTVEPGTYKSNTPTYKSLTEYIRTY
ADNFFFLVEQYTPSNGSLAEQYDRNTGVPLSANDLTWSYAAFLSTLQRRLNIMPGSWGFS
SANTVPTTCSTTTMMGTYSAVAPPFPTSTAHCVAAVTVPVTFWLIEDTYYGENVYMTGNV
SALGDWNASAGYSLNAGLYTSNENLWFATVKGFEPGVTIEYKFYKIEPDNSVTFEGGKNR
VYTVPTGCPVAPQVHAVWQT
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgcgatttgccagcattgttgtaggcatagccagtgtcctgggacacctggccactcct
tcgcctgccaaagaacttgccgcacgctcccctgcagcagcgaattcctacctggtcaaa
gagggactgttcgcctacgagagcattctcgcagctcttgggaacactggcagcaatgct
cctggcacagcggccggattactcattgcaagccctactacacagaaccctgattacttt
tttacgtggactcgtgatgcggcattgactttcaagggacttgtcgatatcttcattgcg
ggcaacacattcatcggtgtcaatttcgacgcccttgaaacccacatccaggactacatc
tcttcccaggcagttttgcagaacgtgtccaacccatctggcagactttctgacgggtct
ggactcggcgagcccaaattcgaggtcaatttcaacccatactccggcggatggggccgt
ccccagcgcgatggtcctgctcttcgcgccattgccatgttgacctatatgcgccaccta
atccagcaaggaaagcagtctgtggcttccaacctgatctggcccgttgttgccaacgat
ctcacctatgtcgctcagtactggaatcacaccggattcgatctctgggaagaagtcgat
ggctcttccttctttacgactgccgttcagcaccgagcgatggttgaaggcagtgtgata
gctaaagctcttgggaagccccatgctgcgtacgacgcggttgctccagagatcctttgt
ttcctgcagagctactggaacggaagcgccattgtctcgaacattaatgtcaataatggc
cggtcgggcatcgatctcaactcagtcctgaccagcattcatacctttgaccctgcggct
ggttgcgatgattcgaccttccaaccctgttcgtctaaagctttggcaaatcataaggtc
tatgtcgattctttccgttctatctacggtatcaacgctggtcttggtcctggaaaggct
gcaaatgtaggccgttaccctgaggatgtttaccagggaggaaacccatggtaccttgca
acccttgcggcagcagagcagttgtatgatgccctctatcagtggaaaaagcaaggttat
ctgaccatcacgcaaacctcgctcgccttcttccgtgacttctcatccaccgtcgagcca
ggaacttacaagtcgaataccccaacctacaaatccctgactgagtatatccgcacctac
gctgataacttcttcttccttgttgagcaatacaccccaagcaacggctccttagctgag
cagtatgaccgcaacaccggcgtccctctgtcggccaacgatctcacctggtcctatgca
gccttcctctccacccttcagcgccgcctcaacatcatgcctggctcctggggcttctcg
tctgcgaatactgttcccactacctgcagcacgaccaccatgatgggcacatacagcgct
gtggcgcctccctttccgacctccaccgctcattgcgttgccgctgtgaccgttcctgtt
accttttggttgatcgaggacacctactatggcgagaatgtgtacatgaccggtaatgtc
agcgctctcggcgactggaacgcgagcgctggctacagtctgaacgccggtctctacacc
tcgaatgagaatctttggttcgcaactgtcaagggattcgagccgggtgttaccattgag
tacaagttctacaagatcgagccggataactccgtgacttttgagggggggaagaacagg
gtgtatacagttcctacgggatgtcctgtggcgcctcaggtccatgctgtttggcagact
tga

DBGET integrated database retrieval system