KEGG   Neosartorya fischeri: NFIA_004540Help
Entry
NFIA_004540       CDS       T01070                                 

Definition
NADPH cytochrome P450
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
nfi  Neosartorya fischeri
Pathway
Fatty acid degradation
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    NFIA_004540
  Amino acid metabolism
   00380 Tryptophan metabolism
    NFIA_004540
Enzymes [BR:nfi01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     NFIA_004540
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     NFIA_004540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 993 aa AA seqDB search
MANNFGPLFQITINGEKQIFATSQALVDELCDESRFHKAVVAGVQNLRMLVNDGLFTAYH
GERGWGIAHRILVPAFGPLRIRNMFEDMSDIAQQLCFKWARQGGSTSINITDDFTRLTLD
TIALCSMGFRLNSFYNSETMHPFVQYMVDVLREADVQAMLPGIANSLRVTAQRRMSKNIE
AMRSIAREIIQGRRDKGESVDDLLNTLLSGRDPVTGEGMTDDSIIDNVITFLIAGHETTS
GLLSFTFYYLLQNPHILEQARNELPYIDAILKETLRLMPTAPAFAVFPKKPEVLGGKWTI
NARQAVIVLLPACLRDQAVFGPDAGEFRPERMLEENFSQLPPNSWKPFGNGERSCIGRAF
AWQEAQLVVAMILQTFDLVGNDPSYKLRIKETLTIKPDGFRLRATLRRGQSATGLSRRSM
SVSADGTSAASSTHLAGKCKGLEPAGGQPVSFFYGSNSGTCKALAHRLASNMMARGFTNQ
KLAPLDSAVDNLPRDQPVIIVTTTYDGQPTDDAKKFIAWLESGKVPALQGVSYAVFGCGH
QDWTKTFYRVPILIDDMMHKAGATRLAARGAANAAVSDLFSDLEKCEETSLLPALRETFL
PSSSSDVELLNPQQLQISLSKPRRVGMHQGLVEVKVTAVRILTSPGTLEKQHVEFRIQGE
TTLRPGDHLNILPANPPSTVSRVLAHFDLAPDYSITINSFNTLGLPHATPVLAAELFSSY
VELSQPATRNNLKALAATALSNADKQELIRFHDSNDPLVRDKRVSVSDLLEQFPSISLPL
AAFISMLPALRVRTYSLSMAPSFKPSHGSLTFSVVNEPAWSGNGQYLGVGSNYLASLTLG
SILYISPRPAKDAFHLPMDQSSEPIIMICAGTGLAPVLSFIQERMVWLQQGKPLAKALLF
FGCRGPHLDDLYHEELSEFESAGVVEVRRAYSKAPDHDLAKGSRYVQHRLVTEAEAIQDL
WAQNAKVYVCGSGNLAKGVQTALENMLGALPQE
NT seq 2982 nt NT seq  +upstreamnt  +downstreamnt
atggccaacaatttcggacccctctttcaaatcactatcaacggcgaaaagcagatcttt
gcgaccagccaggctctggtcgatgagctctgcgacgaatcccgtttccacaaggccgtt
gtcgctggagtccagaacttacgaatgctggtcaacgatggcctctttacagcctaccac
ggagagcgtggctggggcattgctcatcgcattctggtgcctgcctttggcccgctacgt
atccggaacatgttcgaggacatgagtgatatagcgcaacagttatgtttcaagtgggcc
cgccaaggaggttcgaccagtatcaatatcactgatgactttacgcgcctcacattagac
actatcgccctctgctcgatggggtttcggctgaacagcttttataatagcgagactatg
cacccatttgttcaatacatggtggacgtgctgagggaagccgatgtccaagccatgctt
cccgggatcgcaaactccctgcgcgtcacggcccagcggcgcatgtctaagaacatcgag
gcgatgaggagcatagcccgcgaaatcatccaagggcgcagagataaaggggagtcagtc
gatgacctcttgaacacactgttgagtgggcgggacccagtcactggcgaaggcatgacc
gatgactcgatcattgacaatgtcatcacctttttgattgcgggccatgagaccacctcc
ggcctgctctcgttcacgttttactacctgctgcaaaacccgcacatcttggagcaggcc
cggaacgaacttccatacatcgacgccattttgaaggagactctgcgcctgatgccgacc
gccccagccttcgccgtctttccaaagaagccggaggtgctgggcgggaaatggacgatc
aatgccagacaggccgtcatcgtcctgctgcctgcctgcctgcgtgaccaagccgtcttt
gggcctgacgcgggcgagttccgccctgaacgcatgctggaagagaatttctctcagctc
ccgccgaactcgtggaagccatttggcaacggcgaacgcagctgcattggcagggccttt
gcctggcaggaagcccaactggtggttgccatgatccttcaaacgtttgacttggtgggc
aatgacccatcctacaaactccgcatcaaagagactctcaccatcaagcccgatggcttc
cggctccgagccacgttgcgccgcggccagagtgccactgggctatccaggcgaagtatg
tcggtgagcgctgatgggacctcggcggcatcgtcaactcatctcgccgggaaatgcaaa
ggcctggagccggcaggagggcagccggtttccttcttctacggctccaacagcggaact
tgcaaagccctcgcccaccggttggcgtcgaacatgatggcccgtggctttaccaaccag
aagcttgccccgctcgacagtgccgtcgacaacctgccgagagatcagccagtgatcatt
gtaacaaccacctacgatgggcaacccacggacgacgcgaagaagtttattgcttggctg
gaaagcggcaaggtccccgctctccaaggtgtctcctatgcagtcttcggctgcggccac
caggactggaccaaaacattctatcgcgtcccgatcttgattgatgacatgatgcacaag
gctggagccacacgtcttgcggcgcgaggcgcagccaacgctgctgtcagcgatctcttc
tcggacctcgaaaagtgtgaagagacaagcctgctgcccgccctccgcgagacattcctc
ccgtccagcagcagcgacgtcgagctactcaacccgcagcagcttcaaattagcttgagc
aagcccaggagggtgggcatgcaccagggcctcgtggaggtgaaagtgactgccgtccgg
atcctaaccagcccggggaccctggagaagcaacatgtggaattccgcatccagggtgaa
accaccttgcgtccaggcgatcatctcaatatcctcccggccaatccgcctagcacggtc
tcaagagtcctagctcatttcgatctcgcaccggactacagtatcactatcaactcgttc
aacacgcttggtctaccccacgccacacctgtgttggcggccgagctgtttagctcatac
gtagagctgtcccaaccggcaacgcgaaataacctcaaagcactcgccgcaaccgcactg
tctaatgcagacaaacaagagctgatccgtttccatgattccaacgatccactcgtccgg
gacaagcgcgtctcggtttcggatctgcttgaacaattcccctccatctcacttcctctc
gcggcatttatctccatgctcccggctttgcgcgtccggacgtactccctttccatggcc
ccctcattcaagccttctcacggttcgctcaccttctccgtcgtcaacgagccagcatgg
agtggcaatggacagtatctgggcgtcggatcgaactaccttgcctcgctcacattaggg
tccattctctacatatcgccgcgacccgccaaagacgctttccatctcccgatggaccag
tccagcgaacccatcatcatgatctgcgcggggaccggtcttgcccccgtccttagcttt
atccaagagcgcatggtctggctacagcagggcaaaccactcgcaaaggcgctgctgttc
ttcggctgtcgaggtccccatctggatgatctttaccatgaggaattatccgagtttgaa
tccgctggcgtggtcgaggttcgcagagcgtacagtaaagccccggaccatgacctggcc
aagggatcccggtatgtgcaacaccggttggtgacagaagccgaagcaatccaagatctc
tgggctcagaatgcgaaagtctacgtctgcggttcggggaatctggccaagggggtccag
accgctttagagaatatgctaggggcgttgcctcaggagtga

DBGET integrated database retrieval system