KEGG   Neosartorya fischeri: NFIA_004590Help
Entry
NFIA_004590       CDS       T01070                                 

Definition
4-aminobutyrate aminotransferase
Orthology
K13524  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
nfi  Neosartorya fischeri
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    NFIA_004590
   00650 Butanoate metabolism
    NFIA_004590
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NFIA_004590
   00280 Valine, leucine and isoleucine degradation
    NFIA_004590
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NFIA_004590
Enzymes [BR:nfi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     NFIA_004590
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     NFIA_004590
Amino acid related enzymes [BR:nfi01007]
 Aminotransferase (transaminase)
  Class III
   NFIA_004590
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 467 aa AA seqDB search
MTFALSEPPAPSTLTAVPGPSTNATKRELDVIFDARTTQIVVDYEKSYGNYLSDVDGNCF
LDVYAQIASIPVGYNNPALIQAAQSREMISALVNRPAIGNFPSQHWLKLLREGLMRVAPR
GCTQVFTAQSGSEANELAFKAAFMAYQRKQRGPDNQHWSTRELESAMKNQAPGSPDLAIL
SFKDSFHGRGLGSLSATRSKPVHKMDIPSFKWPQATFPRLKYPLEEHEDDNRAEERRCLQ
EVEHILASWYCPVAGVIVEPIQSEGGDNHASPGFFQGLQALTKKHGIYLIVDEVQTGFGA
TGRFWGHEHWELPAAPDIVTFSKKAQTAGYFFSDAMLRPDKAYRQFNTWMGDAARVIISN
AVIDEILSKNLVEHTARIGDILYERLAALSTKFPQLILNLRGKGRGTYIAFDTPDASSLL
KEMRNAGINVGSCGVSTIRLRPMLIFGEEHIPLLLDGFEKVFAKLEK
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgacctttgcactctccgagcctcctgccccttcaacattgactgccgttccgggccca
tcgaccaatgccactaagcgggagctggatgtcatctttgacgcccggacaacgcagatc
gtcgtcgactatgaaaagagttatggaaactacctatcagacgtcgacggcaactgtttt
ctggacgtgtatgcgcagatcgcctcgattcccgtgggctataacaacccagccttaatc
caggcagcccagtcccgcgagatgatctccgctctagtcaaccgcccagcaatcggcaac
ttcccctcacagcactggctgaagctcctccgcgagggtctcatgcgcgtcgcaccccgc
ggttgcactcaggtgttcaccgcacagtccggctcggaggccaacgagctcgcctttaag
gcagctttcatggcctaccaacgcaaacagcgcggcccggacaaccaacactggtccaca
cgtgagctggaaagcgcaatgaagaaccaagcacccgggtccccagaccttgccatcctt
agctttaaggactccttccacggccgcggccttggcagcctctcggccacccgctccaag
cccgtccataagatggatatcccgtcgttcaagtggccgcaggctacattccctcgcctc
aaataccctcttgaagagcatgaggacgataatcgcgccgaggaacggcgctgtctgcaa
gaggtcgagcacattctggcctcctggtactgccccgtcgccggagtaattgtcgagccg
atccagagtgagggtggggataaccatgcatcaccgggtttctttcagggactgcaggcg
ctcactaaaaagcatgggatctacttaattgtcgatgaagtgcagacaggttttggtgcc
acaggcaggttttggggccatgagcattgggagcttcctgctgcaccggatatcgtgacc
ttctcgaagaaggcgcagacggctggatacttttttagtgatgcgatgctgcggccggat
aaggcgtatcggcagtttaacacgtggatgggcgacgccgcgcgtgtcatcatatccaat
gctgttattgatgagatcctctctaagaatctggtcgaacacactgcgcgtatcggcgat
atcctctacgagaggctcgctgctttgtcgaccaaatttccccagctcatcttgaatctc
cgaggcaaaggcaggggcacgtacattgcctttgacactccggacgccagctccttgctc
aaagagatgcgcaatgccggaatcaacgttggaagctgcggtgtgtccactattcggcta
cggccgatgctgatctttggggaggagcacattcctctactgttagatggatttgaaaaa
gtgtttgctaagttagaaaaatag

DBGET integrated database retrieval system