KEGG   Aspergillus fischeri: NFIA_006260Help
Entry
NFIA_006260       CDS       T01070                                 

Definition
(RefSeq) NADH-cytochrome B5 reductase
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NFIA_006260
Enzymes [BR:nfi01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     NFIA_006260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 Cyt-b5 NAD_binding_6 FAD_binding_9
Motif
Other DBs
NCBI-GeneID: 4585407
NCBI-ProteinID: XP_001259159
UniProt: A1DKM3
AA seq 497 aa AA seqDB search
MVYKIRELPASPNQHYLPMVVSAMADASGAQKSPAVDLPEYTLKEVALHNRKDDNWIVIH
GQVYDVTKYQKDHPGGADVLVEVAGSDATEAFEDIGHSEDSREILQEFLIGTLQGAKEYV
APKKVRIIAQSSVETPASSSATRYVGAVTSLLGAVASLIYVYRRGSLYAFDTTGSLYRYL
SQRLSGLRLPQGGFANGFLAATLICAAAGGVIARKAAKFTKIESGFLQYLPHIKARKVPK
VDPHLLKGFLDSKEFQRLPLIQKDQLSSNVYRFVFGLPDSNGVIGLPIGQHVAIRAVIDG
ATVSRSYTPVSNNLDRGRLELVVKCYPDGMLSGKYLANLQVGDEVEFRGPKGAMRYKPGF
CKKLGMVAGGTGITPMYQLIRAICEDERDTTEISLIYANRTEADILLRDELEQFARKYPK
NFKLWYMLDTAPENWAYGSGFVNQEVLSERLFAPSPDTKVLLCGPPGMVSATKKTLAAIG
FQKPGPVSKMTDQIFCF
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggtttataaaatccgtgaactgcctgcctcccccaatcaacactacttaccaatggtc
gtttcagcgatggcagatgccagcggtgctcagaaaagccctgcggttgatttacccgag
tacacattgaaggaagttgcactgcataaccgcaaagacgacaattggattgtgatccac
ggacaagtgtacgatgtgacaaaataccagaaagatcatcctggcggcgcagatgttctg
gttgaagttgccggctcagatgcgacagaagcatttgaagacatcggtcattcagaagat
tcgcgcgaaattttacaagaattcctgatcggaacccttcagggcgcgaaagaatatgtc
gctccgaagaaagttcgcatcatcgctcagagttccgtcgagactcctgcttcttcatca
gcaacccgatacgtaggagcggtcaccagtctgctgggagcagtcgcctccttgatctat
gtctaccgtcgcggttctctgtacgcatttgacaccacggggtcactttacagatatctc
tctcagcgcttaagcgggttaaggttgccgcagggaggcttcgccaatggtttcctcgca
gctactctgatttgtgcggcagcaggtggtgttatcgcacgtaaagcggccaaattcacc
aagatcgagtcggggttcctgcagtatctgccgcatattaaggcacgcaaggtgcccaag
gttgacccgcacttgcttaaagggttccttgactcaaaggagtttcagcgcctgccgcta
atccagaaggatcagttatcctcaaacgtataccgcttcgtgtttgggttaccggatagc
aatggagtgattggtcttcccatcggtcagcacgtcgccattcgcgctgttatcgacggt
gccaccgtgagccggtcgtatacacccgtttccaacaacctagaccgaggaagactggaa
ttagtcgtgaaatgctatccggacggcatgctctctgggaagtacctagccaacctgcaa
gtgggtgacgaggtcgagttcagaggacccaaaggcgcgatgcgctacaaaccagggttc
tgcaagaagctgggaatggtagctggcggaacaggaatcacacctatgtaccagctgatc
cgtgctatctgcgaggacgagcgtgatacgacggagatcagccttatctacgccaataga
actgaggcagacatcttactgcgggatgaactcgagcagtttgcccgcaaataccccaag
aatttcaagctgtggtacatgcttgacactgccccggagaattgggcgtatggaagcgga
ttcgtcaaccaggaggtcctcagcgagcggctattcgcgccttcgcctgacactaaggtt
ctcctctgcgggcctccgggcatggtgagcgctaccaagaagacgctggctgcgattgga
ttccagaagccagggccagtttcgaagatgaccgaccagattttctgcttctaa

DBGET integrated database retrieval system