KEGG   Neosartorya fischeri: NFIA_006260Help
Entry
NFIA_006260       CDS       T01070                                 

Definition
NADH-cytochrome B5 reductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
nfi  Neosartorya fischeri
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:nfi00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 497 aa AA seqDB search
MVYKIRELPASPNQHYLPMVVSAMADASGAQKSPAVDLPEYTLKEVALHNRKDDNWIVIH
GQVYDVTKYQKDHPGGADVLVEVAGSDATEAFEDIGHSEDSREILQEFLIGTLQGAKEYV
APKKVRIIAQSSVETPASSSATRYVGAVTSLLGAVASLIYVYRRGSLYAFDTTGSLYRYL
SQRLSGLRLPQGGFANGFLAATLICAAAGGVIARKAAKFTKIESGFLQYLPHIKARKVPK
VDPHLLKGFLDSKEFQRLPLIQKDQLSSNVYRFVFGLPDSNGVIGLPIGQHVAIRAVIDG
ATVSRSYTPVSNNLDRGRLELVVKCYPDGMLSGKYLANLQVGDEVEFRGPKGAMRYKPGF
CKKLGMVAGGTGITPMYQLIRAICEDERDTTEISLIYANRTEADILLRDELEQFARKYPK
NFKLWYMLDTAPENWAYGSGFVNQEVLSERLFAPSPDTKVLLCGPPGMVSATKKTLAAIG
FQKPGPVSKMTDQIFCF
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggtttataaaatccgtgaactgcctgcctcccccaatcaacactacttaccaatggtc
gtttcagcgatggcagatgccagcggtgctcagaaaagccctgcggttgatttacccgag
tacacattgaaggaagttgcactgcataaccgcaaagacgacaattggattgtgatccac
ggacaagtgtacgatgtgacaaaataccagaaagatcatcctggcggcgcagatgttctg
gttgaagttgccggctcagatgcgacagaagcatttgaagacatcggtcattcagaagat
tcgcgcgaaattttacaagaattcctgatcggaacccttcagggcgcgaaagaatatgtc
gctccgaagaaagttcgcatcatcgctcagagttccgtcgagactcctgcttcttcatca
gcaacccgatacgtaggagcggtcaccagtctgctgggagcagtcgcctccttgatctat
gtctaccgtcgcggttctctgtacgcatttgacaccacggggtcactttacagatatctc
tctcagcgcttaagcgggttaaggttgccgcagggaggcttcgccaatggtttcctcgca
gctactctgatttgtgcggcagcaggtggtgttatcgcacgtaaagcggccaaattcacc
aagatcgagtcggggttcctgcagtatctgccgcatattaaggcacgcaaggtgcccaag
gttgacccgcacttgcttaaagggttccttgactcaaaggagtttcagcgcctgccgcta
atccagaaggatcagttatcctcaaacgtataccgcttcgtgtttgggttaccggatagc
aatggagtgattggtcttcccatcggtcagcacgtcgccattcgcgctgttatcgacggt
gccaccgtgagccggtcgtatacacccgtttccaacaacctagaccgaggaagactggaa
ttagtcgtgaaatgctatccggacggcatgctctctgggaagtacctagccaacctgcaa
gtgggtgacgaggtcgagttcagaggacccaaaggcgcgatgcgctacaaaccagggttc
tgcaagaagctgggaatggtagctggcggaacaggaatcacacctatgtaccagctgatc
cgtgctatctgcgaggacgagcgtgatacgacggagatcagccttatctacgccaataga
actgaggcagacatcttactgcgggatgaactcgagcagtttgcccgcaaataccccaag
aatttcaagctgtggtacatgcttgacactgccccggagaattgggcgtatggaagcgga
ttcgtcaaccaggaggtcctcagcgagcggctattcgcgccttcgcctgacactaaggtt
ctcctctgcgggcctccgggcatggtgagcgctaccaagaagacgctggctgcgattgga
ttccagaagccagggccagtttcgaagatgaccgaccagattttctgcttctaa

DBGET integrated database retrieval system