KEGG   Neosartorya fischeri: NFIA_008580Help
Entry
NFIA_008580       CDS       T01070                                 

Definition
protein kinase (Lkh1), putative
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
nfi  Neosartorya fischeri
Brite
Enzymes [BR:nfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     NFIA_008580
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 664 aa AA seqDB search
MSTPSTATATHPTHHQQHYAFPHHHAYQPNASFPVTTATGTARLATAPYPYAAPPSTAPL
PYNQSSKMVQPASTPAAIPPAQSEVSTGTAGSDQSRRRKKPDWGEFYKNGIPKEVIVIDD
TPPPEQGKGKSRTTAAAASNGGMAQPAGKKRRTGIESAYDLGYYDRPSFSTIPQQYGEES
SAASISTDRTTSLHTTAPTSLGSQGSAGATNGVYYEDANVGQKRKRVTTRKSARDEQKRR
ELETAGDAFLSYIPPPKPPIKAKEVPVPVVRDYGNRHEKYDDDDGHYIVTPDTPLTDRYS
IIKLLGQGTFGKVVEAYDRQRKTRCAVKIIRSIQKYRDASRIELRVLSTLASNDKSNRNK
CIHLRDCFDFRNHICIVTDLLGQSVFDFLKGNGFVPFPSSQIQNFARQLFTSVAFLHDLN
LIHTDLKPENILLVSNAYQTFTYNRTIPSSSHAVSRNARQRRVLLDSEIRLIDFGSATFD
DEYHSSVVSTRHYRAPEIILNLGWSFPCDIWSIGCILVEFFTGDALFQTHDNLEHLAMME
AVIGSKIDTKLVKQTTQGGRNGSQNQAAKYFNRNKLDYPNEETTRASRKYVRAMKQLTDF
IPTSTTFHRLFLDLLQRIFVYDPKNRITAKEALKHPWFKESLIDDGTEALRIGQQLQRNG
GQRS
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgtctacaccctcaacggccactgcaacgcatcccacgcaccaccagcaacactacgca
tttcctcatcaccacgcctaccagccaaacgcctcctttcccgtcacaaccgctacgggg
actgctcgcctagccactgcaccctacccgtacgccgcccctccttcgaccgcacccctt
ccttataaccaatcttcgaaaatggtacagcctgcctccaccccagcagccattccaccg
gctcagagcgaagtcagcacgggcacagccgggtcagatcaaagcagaaggaggaagaag
cccgactggggcgagttctataaaaatggcattcccaaagaggtcattgtgatcgatgat
acgcctcctccagaacagggcaaaggcaagtcccgtaccactgcggcagcagcctcgaac
ggcggcatggcccaacctgccggcaagaaaaggcgcactggaattgaatcagcctatgac
ctgggatactacgatcgtccatcattttccaccattcctcagcaatacggtgaagagtcc
tccgcagcctccatttctacagaccgcacaacttccctacacaccaccgctcccacatcc
ctgggttcgcagggcagtgcgggtgctaccaacggtgtatattatgaagacgccaatgtt
ggccagaagcggaaacgtgtgacaacacgcaagtcagcccgcgatgaacagaaacggcgg
gaattggaaactgccggtgatgcattcctcagctacatcccccctcccaagccaccgatc
aaggcgaaggaagtcccagtgcctgttgttcgagattatggaaatcgccatgagaagtat
gacgatgacgacggtcactacattgtgacgccagatacgccattgacagatcgatactca
atcatcaagcttctaggacaaggtacattcggtaaagtggttgaagcgtatgacaggcag
cgcaagactcgctgcgcagtcaagatcattcggtcgatacaaaaataccgtgacgcgtcc
agaattgaacttcgggttctgtcaacgttggcctcgaatgacaaatcgaaccgaaacaag
tgcattcacctacgtgattgcttcgatttccgaaaccatatctgcattgtcacggatctt
ttgggccagagtgtctttgatttcctcaaaggcaacggctttgtgccctttcccagtagc
cagattcagaacttcgctcggcagctattcacgagcgtagccttccttcatgaccttaac
ctcatccataccgatctgaaacccgagaacatcctcctcgtcagcaacgcataccagaca
ttcacctacaaccgaacgattccatcctcttcacacgccgtttcacggaatgcccgtcag
cgacgtgtgttgttggacagcgaaatccgtctcatcgatttcgggtcggccactttcgat
gatgagtatcactcatcggtggtatccacgagacattatcgtgctcccgaaattatcttg
aatctgggctggagtttcccgtgcgatatctggagtatcggctgcattctggttgagttc
ttcaccggggatgcccttttccagacgcacgacaacctagaacatcttgccatgatggag
gcagttattggctctaaaatcgatacgaagctggtcaagcagacgacccagggaggtcga
aacggaagtcagaaccaggcggccaaatacttcaaccgaaacaagctggattatcctaat
gaggaaacgacacgagcctcgcgcaagtatgtgagggctatgaagcagcttactgacttc
atcccaaccagcactacattccatcgcttgttccttgaccttctccagcggatatttgtc
tacgatcccaagaaccgtatcactgccaaagaggctctgaagcacccgtggttcaaggag
tctttaattgatgatggcaccgaggctcttcgcatcggtcaacagttgcaacgcaacggc
ggtcaacgcagctag

DBGET integrated database retrieval system