KEGG   Neosartorya fischeri: NFIA_009350Help
Entry
NFIA_009350       CDS       T01070                                 

Definition
MAP kinase kinase (Pbs2), putative
Orthology
K11227  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
nfi  Neosartorya fischeri
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    NFIA_009350
Enzymes [BR:nfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     NFIA_009350
Protein kinases [BR:nfi01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   NFIA_009350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 656 aa AA seqDB search
MSAATVGPEQESVAEVPSAQVDIDNRSDNTTDDDLSPSVTAPPSLTSVPSLRPDQDMTSG
ISASSTHLGQINAARRGVGTPTRPHASMSGAQPGGLNQDILAKMKAFSLSRQGAPPYLPH
AVSTGTIPSSRPSISASPSPVGGPSPPMGGALAGRLPPTARPHGKNWASSPSVPGATAGS
HSPSPKTGSLAAKRMKPGLKLSDATGPATGSGTSSPGDGSSDASGGSAFSKYSEYIDTKA
GTLNFKNKAILHGGGVEFSSGHSFSISLDEVERLDELGKGNYGTVYKVRHSRPHMRKPGM
GLRGIVSRPTENSTPDSTSAAKPQDNLSGYIMAMKEIRLELDENKFAQIIMELDILHRCV
SPFIIDFYGAFFQEGAVYMCVEYMDGGSIDKLYKDGVPENILRKVALSTVMGLKTLKDDH
NIIHRDVKPTNILVNSRGQIKICDFGVSGNLVASIAKTNIGCQSYMAPERIAGGGVQQSG
ATGGGTYSVQSDIWSLGLTIIECAIGRYPYPPETFNNIFSQLHAIVHGDPPTLPEQGYSE
EAHAFVRACLDKTPSKRPSYSTLLRHPWLAPLMQPPTESNGTEATSAASSDGQPGGPDTS
TATEDEEVAEWVKERIERRQRGHLQEAEKPALHAVALDAVPGSPLLDDPSSLPSLS
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcggctacagtgggcccagagcaagaatcggtcgcagaggttccctccgctcaa
gtcgatattgacaaccgatccgacaacacaaccgacgatgacctttccccctctgtcact
gctcctccgtctcttacttcggtaccatcccttcggccggaccaggatatgacatcgggg
ataagtgcttcgtctactcatttgggccaaatcaatgcggctcggcgtggtgtagggacg
ccgacacggccgcacgcctccatgagtggcgcacagccgggcggtttgaatcaggacatc
ctggccaagatgaaggccttctccctctccagacagggtgctcccccgtatttacctcat
gctgtctctaccggaacgatcccttcgtccagaccaagcatttccgcttcgccaagtccg
gtaggagggccatcgcctcccatgggaggtgcacttgccgggcgtcttcccccgacagcg
cgccctcatggtaaaaattgggcgtcttcgccctcagtgccgggagctactgcaggttct
cattcgccttcgccgaaaaccggcagcctggccgcaaaaagaatgaagccagggttgaaa
ctgtcagatgccactggccctgcgactggttctggaaccagctcgcctggcgatggatct
tcggacgcatctggagggtcggcattcagcaaatattctgagtacattgacaccaaggca
gggactctgaatttcaaaaacaaggcgatcctgcacggtggcggcgtcgaattctcgtcc
ggacatagtttcagcatctcgttagatgaggttgagcgactggatgagctaggtaagggc
aactacggaacggtctacaaagttcgacatagccggccccatatgcgcaaacctggtatg
gggcttcgcggcatcgttagtcgcccaactgagaactcgaccccggatagcacttccgcg
gctaagccccaggacaatctttccggttacattatggcgatgaaggagattcgcttggag
ctggatgaaaacaagtttgcccagatcatcatggagttggatattttgcaccgttgcgtt
tcgccattcattatcgacttctacggcgcattctttcaggagggtgcggtctatatgtgt
gtggaatatatggacggaggctctatcgataaactctacaaggacggcgtacccgaaaac
attctccgaaaggtcgcattatccaccgttatgggattgaagaccctcaaagacgatcat
aacatcattcatcgggacgtgaagcctaccaatattcttgtcaattctcgaggtcaaatc
aagatttgcgatttcggtgtgagcggcaatttggtcgccagtatcgcgaagacaaatatt
ggctgccagagttatatggcaccggaacgtattgcaggaggcggcgtgcagcagtcaggc
gcgactggtggtggaacttatagtgtgcagagcgacatctggagtttgggcctgaccatc
atcgaatgcgctatcggtcgctatccatatcctccggaaacttttaacaacattttcagc
cagttgcatgctatcgtgcatggggatccgccaacattaccggagcaaggatattcggaa
gaggcgcatgcattcgtccgcgcttgtttggataaaactcccagcaagcgtccttcatat
agtaccttactcagacatccctggcttgctcccttgatgcagcccccgacggagtcgaat
ggtaccgaggcaacatccgccgcttcgtctgacggccaacctggcgggcccgatacgagt
actgcgaccgaggatgaggaagtggcggaatgggtcaaggagcgaattgaacgtcgccaa
cggggacacctacaagaggcagagaaacctgcattgcatgcagtggccctggatgcagtg
cccggtagccctctgcttgatgatccctcctcgctaccgtcactttcttag

DBGET integrated database retrieval system