KEGG   Neosartorya fischeri: NFIA_009390Help
Entry
NFIA_009390       CDS       T01070                                 

Definition
choline kinase, putative
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
nfi  Neosartorya fischeri
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NFIA_009390
Enzymes [BR:nfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     NFIA_009390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 748 aa AA seqDB search
MMGSDQFLEGVKPILGTGLNISSFQKILTENGHASTAIAANEGSPSKQHRAPVAKKPTTR
TPLHHTSQTPSVVSESRSQCEKEQGAKISEENSHDGLFHQVYEWLQQEKVKQKSRRSKLR
GTGEGVESDGDDDYYDGILDKTASHDSESAFALDKLEKILLRYAASRIEGSSSAYPLRGP
TRKRSRIKGLRRGSASESDQYDLDTAVPAVDAVLDNSKTLAYTGGTAEEDDRRSKDKEAW
LTFKNEIVRLAITLQIKGWRKFPQELAGEIEVIRLSGALTNAVYVVNPPKSLPPPKGEDG
SYSLVPRKPPPKLLLRIYGPQVDHLIDRENELQILRRLGRKNIGPKVLGTFNNGRFEEFL
EARPLTPKDLRVPETMKQIAKRMRELHEGIELLEEEREGGPVVFKNWDKWVDRCEQVINW
LDMEIQSDHNEAKAASEPWRRRGFVCGVPWPIFRKAVENYRKWLVSSCGGIKEIKRQLVF
AHNDTQYGNLLRMEPASESPLLLPENKHKQLVVIDFEYASANTPGFEFANHFSEWCYNYH
DPERAWACNNRHYPTPEQQRMFIASYLTHRPGVRSATSPSITPLMRGNSATMTSLAPLDL
DSMTEADLQGQLEAEKSQEDSLEAELHFLMKQTRLWRVFNSAQWVAWGIVQAKVPGMEEG
IAAAAAAKASNGNGHSSDSSGSAVAAAERPAQPPVDADVDEADEFDYLAYAQDRAMFFWA
DLLALNLVREDELPPRMVEHIKSRMIEY
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgatgggatctgaccaatttttagaaggggtgaagccaattttgggaactggccttaat
atctcttcttttcagaagattctcactgaaaatgggcatgcgagcacagcaattgcggca
aatgaaggtagtccttccaagcagcaccgcgcgccagtggccaagaaacccacgactcgg
accccattgcatcatacatcgcagacacctagcgtcgtaagtgaatctcgcagccagtgt
gagaaagagcaaggcgcgaagatcagcgaagagaactctcacgatggcctgtttcaccaa
gtatatgagtggctccaacaagaaaaagtgaaacaaaaaagccgccggtcgaagttgaga
gggacaggcgagggtgtcgaaagtgatggcgatgacgattactacgatgggatcctggat
aagaccgcatctcacgactccgaaagtgcatttgctctcgacaagctcgaaaagatcctc
cttcggtacgccgcttcccgcattgagggctcctcgtcggcctatccactacggggacca
acccgcaagcgttcccgcatcaagggtctgcgcagaggctctgcgtccgaatccgatcag
tatgatcttgacacggcagttcccgctgttgatgcagtactggacaattccaagacgctc
gcatacacaggcgggaccgccgaggaagacgatcgacgatcgaaggataaggaagcttgg
ttgacgttcaagaacgagattgttcgccttgccattacgcttcaaatcaaaggttggcga
aagtttcctcaggagcttgctggcgagattgaggtaatcagattgagtggtgccttgacc
aacgcagtgtatgtggtcaatccaccaaaatccctccctccgcctaaaggcgaagatggg
tcttattctcttgttcctcgaaagcccccgccgaagcttctattgcgtatctatggtccg
caggtggatcacttgattgacagagagaacgagctgcagattcttcgtcgcttaggccgg
aagaacattggacccaaggtactggggacgttcaacaacggccgattcgaggagtttttg
gaagcgcgtccactcacgcccaaggacttgcgtgttccggagaccatgaagcagattgcg
aaacgtatgcgcgagctgcacgaagggatcgaactgcttgaagaggagagagaaggcggc
ccggtagtcttcaaaaactgggacaagtgggttgatcgctgcgagcaagtcatcaactgg
ctggacatggaaattcagtctgaccacaacgaggccaaggcagcttcggaaccctggcgc
cgtcgcggatttgtttgtggtgttccatggcctatcttcagaaaggccgtcgaaaattac
cggaaatggcttgtatccagctgcggagggatcaaggagatcaagcggcagttggttttt
gcgcacaacgatactcaatatggcaatctgcttcgaatggaacccgcctccgaatcgccg
cttcttttgcctgaaaacaagcacaagcaactggtagtcattgactttgagtatgcttcg
gcaaataccccagggttcgagtttgcgaaccattttagcgaatggtgttataactatcac
gatcctgagagagcctgggcgtgcaacaaccgacactatccaacacccgagcagcaacgc
atgttcatcgcctcatatctgacccatagaccaggagtgcgatcggccacttctccgtcc
atcactcccctcatgcgaggaaactcggcgaccatgacctcattagcgcctctggacctc
gactcgatgaccgaagcagacctccagggccagttggaggccgagaagtcgcaggaagat
agcctggaggccgagctccacttcctgatgaagcagacgagactctggcgcgtgttcaac
tctgctcagtgggttgcctggggaattgtacaggccaaggtacccggtatggaggagggg
attgcggcggccgcagcggcgaaagcgtctaatgggaacggtcacagcagtgattcaagc
ggatcagcagtggcagctgctgagcgaccagcgcagcctccagtcgacgcggacgtggac
gaggcggacgagtttgactatcttgcctacgcgcaggatcgggcgatgttcttctgggcg
gatctacttgcgctgaatttggtccgggaggatgagctcccacctcggatggtggagcat
atcaaatctcgcatgatcgagtattag

DBGET integrated database retrieval system