KEGG   Neosartorya fischeri: NFIA_009400Help
Entry
NFIA_009400       CDS       T01070                                 

Definition
26S proteasome-associated ubiquitin C-terminal hydrolase, putative
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
nfi  Neosartorya fischeri
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 316 aa AA seqDB search
MADGGGWSTIESDEGVFTSLIENLGVKDVQFEELISLDADTIRSLSPVYGVIFLFKWIRE
PPSTNTTQPLDGTYITSLPENLFFAAQTIQNACGTQAILSVILNQDSPASTPYPINIGPE
LRSFKDFTTGFPPDLRGEALSNSETIRTAHNAFARASPFVDETVRTAQDEEADVYHFIAY
TPVNGVLYELDGLQPYPISHGECDAETFPEKVIEVLQRRIARYPEGETRFNLMAVVRDLR
VRARETGDVELLEREGRKRRAWAWENTLRRWNFVGFIGEMIKGVVGMKEKEGPGAYEAWV
DKAKQETQKRLLSRRG
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggccgacggcggaggctggagcacgatcgagtcggatgagggcgtcttcacctccctg
atcgagaatctcggcgtcaaagacgtccaattcgaggaactcatctccctcgacgcagac
acaatccgctcactcagcccagtctacggcgtcattttcctcttcaaatggatccgcgaa
cccccctcaacaaacaccacccaacccctcgacggcacctacatcacctccctccccgag
aacctcttcttcgccgcccaaaccatccagaacgcctgcggcacgcaggccatcctctcc
gtcatcctaaaccaggactcccccgcctcaaccccctaccccatcaacatcgggcccgag
ctccgctccttcaaggacttcacgaccggcttcccgccagacctccgcggcgaggccctc
tccaactcggagaccatccgcaccgcgcacaacgccttcgcgcgcgcctcgcccttcgtc
gatgagacggtgcgcacggcgcaggatgaggaggcggatgtctaccatttcattgcgtat
acgcctgtcaacggggtgctgtatgagcttgatgggttgcagccgtatccgattagtcat
ggcgagtgtgatgctgagacgttccctgagaaggtgattgaggtcttgcagcggcgtatt
gcgcggtatcctgagggggagacgcggtttaatcttatggccgtggtgagggatttgagg
gtccgcgctcgggagacgggggatgtggagttgttggagcgggaggggaggaagagacgc
gcgtgggcgtgggagaataccctgcgccggtggaattttgtagggttcattggggagatg
atcaagggggtggtggggatgaaggagaaggaggggcctggggcgtatgaggcgtgggtg
gacaaggcgaagcaggagactcagaagagattgttgagtcggagaggttaa

DBGET integrated database retrieval system