KEGG   Neosartorya fischeri: NFIA_010300Help
Entry
NFIA_010300       CDS       T01070                                 

Definition
dsDNA-dependent ATPase (Rad54b), putative
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
nfi  Neosartorya fischeri
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NFIA_010300
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     NFIA_010300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 969 aa AA seqDB search
MVFKPFKPPLIRKQPNLSVSDAPPASGAAEHREPQAKKQRLDPEITTHSNSLNRSHAPSR
KPLQQVINAGSSPSESRTSDDSYGDGYYNVLWRKPSTKKNKTWDGDGIISARDGYLYLQD
ISGKDMGRVMHGSRLEAGTILSIGGKEVEIDSEIPRKEYLAGRPFLERTVVTGPVTAPAP
PKKTFTPLLGNRSGTSLLTTSSQKSQGGKIGSSTLPNPAIRPSSISNAYKRPLLESSVVP
AGPVGTPVPRHDPNQPGALVMKRPDSVPKGKQIVDVVVDPILSKHLRQHQREGVQFLYEC
VMGMRSFNGEGAILADDMGLGKTLQTITLLWTLLKQNPIHESPPVIKKALIVCPVTLINN
WRKEFRKWLGNERIGVFVFDDKRKRLTDFTMGRAYSVMIVGYEKLRTVQEGLARGAGVDI
IIADEGHRLKTLQNKSGQAIQSLNATKRIILSGTPIQNDLKEFFAAVDLVNPGILGNFKA
FVREFEGPIVKSRQPEATKKEIEKGEARNEELRELTSKFMLRRTADILAKYLPPKTEYVL
FCNPTSTQANIYKNVLASPVFQCAIGNSENALQLITILKKLCNSPSLLSPKTGDEKPSET
IAALLSSLPPNLLRHFSPSCSAKIRVLDQLLHNLRTSTSEKIVLVSNYTSTLNMLANLLN
SLSLPFLRLDGSTPAQKRQALVEDFNRLPPNLCFAFLLSAKAGGTGLNLIGASRLVLFDV
DWNPATDVQAMARIHRDGQKRHCWIYRVLLKGSLEERIWQRQVTKIGLADSVMEHKSSVA
QFSRDELKDLFRLDEASRCQTHELLGCDCGGLGRMAGPSSDDASIPATDAEDSPSSDLSD
TDHEFPDIPTLIKASQLNIEEQERRIRSHLRDGHRSRNRKSKRGNDSAGDEPAKQSRIQQ
SLSHYVHIDPGLLSAATDETVIDLQAALDDDDVLLPLLKDEDNRVSFIFKKSSTAEAKGK
RPPSPVVVD
NT seq 2910 nt NT seq  +upstreamnt  +downstreamnt
atggtcttcaagccattcaaaccccctctaattaggaaacagcccaacttatccgtctct
gatgcacccccggcaagcggtgccgccgaacatcgcgaacctcaagccaagaagcagcgc
ctggacccagaaatcacaactcatagtaattcactaaaccgatcacacgcgccgagccgc
aagcctctacagcaagtgatcaatgcaggcagctcacccagcgagagcaggactagtgat
gattcatatggggacggatactacaacgtgctatggcgaaaaccgtccacgaagaagaac
aagacgtgggacggtgacggtatcatctctgcccgtgatgggtatctctacctacaggac
atatcggggaaggatatgggacgggtgatgcatggatcccgacttgaagcaggaaccata
ctctcgataggaggcaaagaagtcgagattgactcggagatacccaggaaggagtatcta
gccggcaggcctttcctcgagagaacagtcgtcactggccccgttacggcaccggcaccg
ccgaagaagacgttcacgccgttactcgggaaccgaagcggtacctcgcttctgacaact
tcaagtcagaagagccagggtgggaaaataggcagctcgactttaccaaatccggcaatc
agacccagctctatatccaatgcatacaagagaccgctactagaaagcagcgtcgttccc
gcggggcccgttgggacgccagttccacgccatgacccgaaccaacccggagcactggtc
atgaagcgaccggattcagtgcccaaggggaagcaaatcgttgacgttgttgtcgatcca
atcctctcgaaacacttgcgacagcaccaacgggagggcgtccaattcctttacgagtgc
gtcatgggaatgcgatccttcaacggagaaggcgctatccttgccgatgacatgggcttg
gggaagactttgcaaacgatcacgctgctctggactctgctgaaacagaatccgatccat
gaaagccctccagtgatcaagaaagcactcatcgtttgcccagtgacattgatcaacaac
tggaggaaggagtttcggaaatggctgggcaacgagcgcatcggtgtattcgtctttgat
gataagaggaagcgtttgaccgatttcactatgggcagggcctatagcgtcatgatagtg
ggatacgagaagcttagaaccgttcaagaaggcctcgcgagaggtgcgggagtcgacatc
attatcgccgacgagggccacagactgaagacgctccagaacaagagcggccaggctatc
cagtcactgaacgccacaaagagaatcatcctttctggcacaccaatccagaatgacctg
aaggaattcttcgcggcagtggacttggtaaatccaggtattttaggaaacttcaaggcc
ttcgtcagagaatttgaggggcctatcgtaaagagcaggcagccggaggcaaccaagaag
gagattgagaaaggcgaagctaggaatgaggaactgcgagagctcacttccaagttcatg
ctacgcaggacggccgacatcctggcgaaatacctgccgccgaaaacagaatatgtcttg
ttctgcaacccgacctccacacaagccaatatctacaagaatgtgctcgcctctccagtg
ttccagtgtgccatcggcaattcagaaaacgccctgcagctcatcaccattcttaaaaag
ctctgcaacagcccttcgctgctttcacctaagactggagacgaaaaacccagtgagacc
atcgcagcgcttttgtcgtccctgcctccgaatctcttacgccacttctccccttcatgc
agcgcaaaaatacgtgtacttgatcagttactccataacctacgcacatctacttcagag
aagatcgtcctcgtctcgaactacacctcgacgctgaatatgctcgcaaacctgctcaac
tcgctctctctgcctttcctgagactagatggctcaaccccagcgcagaaaaggcaggcc
ctagtagaagattttaaccgtctacccccaaatctttgtttcgcgtttctcctttccgca
aaagcaggaggcaccggactaaatttgataggcgcaagccgccttgtcctcttcgatgtg
gactggaacccagccaccgacgtacaagccatggcgcggatccaccgcgacggccaaaag
agacattgctggatctaccgcgtcttgctgaagggaagcctggaggagagaatctggcaa
cgccaggtaaccaagatcggactggcagacagcgtcatggaacacaaaagcagtgtggct
caattctcaagggatgagctgaaggatctcttccgtctcgacgaggcgagccgctgtcag
acgcatgagcttctgggctgcgactgcggtggattagggcggatggctggcccatcgagc
gacgacgccagcattccagccacagatgcagaggactcaccgtccagcgacctctcagac
acggaccatgaattcccggacattcccacactcatcaaagcgtcccagctcaatatagaa
gaacaagagcggcggatccgttcgcacctgcgtgatggccatcgaagtagaaaccgcaag
agcaagcgaggaaacgacagcgcgggcgacgagccagccaaacaaagccgaatacaacaa
tcgctctcccattacgtgcatatagaccctggtttgttatcagccgcgacggatgaaaca
gtaatcgatttgcaggccgcacttgatgacgacgacgtccttcttcccttactcaaagac
gaggataacagagtctcgttcattttcaaaaagtctagtactgcagaggcgaaggggaag
aggcccccctcgccggtggttgtagactag

DBGET integrated database retrieval system