KEGG   Aspergillus fischeri: NFIA_012260Help
Entry
NFIA_012260       CDS       T01070                                 

Definition
(RefSeq) 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase 1, putative
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00562  Inositol phosphate metabolism
nfi01100  Metabolic pathways
nfi04070  Phosphatidylinositol signaling system
nfi04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    NFIA_012260
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    NFIA_012260
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    NFIA_012260
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     NFIA_012260
Membrane trafficking [BR:nfi04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    NFIA_012260
 Endocytosis
  Macropinocytosis
   Phospholipase C
    NFIA_012260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_like EF-hand_7 EF-hand_1 GDPD
Motif
Other DBs
NCBI-GeneID: 4591968
NCBI-ProteinID: XP_001264434
UniProt: A1D294
AA seq 1144 aa AA seqDB search
MAYTTTSLPAALNGDAQPSLNINNSLPNPPKLHHVITSFSPATQTSSTTSYMSSLTTTPS
SLFPTSNHSNASSPSGTPLQIAADALRGRLSSFPPVSLSSFELGESMMAVPGNPATSNVD
SAGPNPNKGAGLMRRISRGAASKLTRRRQSATHSDKRDRSSGPVIMRRRSDSKTAAQTGR
ECALDSSNEEDSNDAVDSLGAWCGSEASSLPNDANMMASRNAGAVAPKVDSAIQRGTVLT
KVTKKRKKQVRFFLNLDAGKVYWDLSNPAKRFYIDDIKEVRVGADARNYREEHQVPQDVE
GRWFTIVIADPEKSKGRSVKTLHLIAPNDHILELWTTTLENISQYRINLMAGLAGSGQSE
TVLKAHWQREMSRLFPQGLAPGEEESLDFGAVETVCRSLHINCSKNMLRAQFSKADLGSK
GRLNFSEFQNFVARLKERKDIKDLFKTWAANAQGGLTVDEFLAFLRDAQQEDVDTDRAYW
VSVFDKYVRKSKPRAPSLPEGVERQAFRMSLEAFSAFLSSNWNGIYASRPPQSRFDRPLN
EYFISSSHNTYLLGRQVAGASSTEAYISALSQGCRCVEIDCWDGADGRPIVSHGRTMTTS
VLFADCITVINRYAFITCDFPLILSLEVHCNPEQQLAMVKIMKDTFKERLVLEPLLTNSF
VLPSPEELKGRILVKVKTCDETLEGVRQDTSTTFASTGRKRSSSSPWMRPSVPENPLFMN
LPPLSSPATIGQESVGPFVSQDRRSFTTTSMSSATEDSDGALVSVKRERRRQKSKITKPL
SDLGVYTRGYKWHSFSSPESQRFNHVYSFAERAFESICRDAENKALLERHNQKYLTRVYP
SGFRLRSSNFDPLKFWRRGVQMAALNWQTYDIGMQLNQAMFAAGTDRTGYVLKPEALRLP
PYEQASTASTERKLVRFSVEVISAQQLPRPRTMGPDDNINPYVEIEMFSADDRGQSFVVG
EGGMNASARNGVSGIGYPHRRRTKIEQSNGYSPTFNDRFKLSLETKYPDLVFVRWTVWSS
LDGRSAGNNNSVQLATFTAKLSSLSQGYRYLPLYDLGGDQYLFSTLFCKITKEEPVPVQR
LGAEELRAERLGILRQIGQTVFKRGSSTDRSEKGSETPASPDDKDTSPALTPTVSTTSTS
SLFL
NT seq 3435 nt NT seq  +upstreamnt  +downstreamnt
atggcttatactactacttcgttgcctgcggctctgaatggcgacgctcaacccagttta
aatatcaacaattctctccccaaccctccaaaattacaccatgtcatcacgtctttttcg
cccgcaactcagacctcctcgacaacctcttatatgtcttcgctcacaactactccctca
tctcttttccccacttccaaccattcgaatgcttctagcccttcaggcacaccattacag
atcgctgccgacgcccttcgggggcgtttatcttcttttcctcccgtttcgctttcctct
ttcgaacttggagagtcaatgatggctgtcccaggtaatccggcgacctcaaatgtggac
tctgcgggccccaatccgaataaaggcgctggcctgatgcggagaatatcgagaggcgca
gccagcaagctcacgcgaagaagacaatctgcgactcacagtgataaacgagatcgcagc
tccggtccggtcatcatgcggcgacgcagcgacagtaaaaccgcagctcagaccggacgt
gagtgtgctcttgattctagcaacgaagaagatagcaacgacgcggtggattctctgggt
gcctggtgtggctcggaagcgtccagtctcccgaatgatgccaacatgatggcctcgcgc
aacgcgggcgctgttgcgcccaaagttgattcggcgattcagcgcgggacggtgttgacg
aaagtgactaagaagcgcaagaagcaggtgcgcttcttcctcaaccttgatgcaggcaag
gtttactgggatctgtcaaacccggcgaaacgcttttatattgacgatatcaaggaggtc
cgcgtcggagcggatgcgcgcaactatcgcgaggaacaccaagttcctcaggatgttgaa
ggccgctggttcaccatcgtcattgctgatcctgaaaagtccaagggtcggtccgtcaag
acgttgcacctcattgctcccaatgaccatatccttgaactttggacaacgactctggag
aatatctctcagtatcgaatcaatctcatggctggcttggctgggtccggtcagagtgag
actgtcttaaaagcgcactggcaacgtgaaatgtcaaggctgttccctcagggcttggca
cccggcgaagaagagagccttgacttcggtgccgttgaaacagtttgtcgaagcttgcat
atcaattgttcaaagaacatgcttcgagctcagttctccaaggctgatcttggcagcaag
ggtcgacttaacttttcagagtttcagaactttgtcgctcgtctaaaagaaaggaaagat
atcaaggacctgtttaaaacgtgggccgcgaatgcccagggaggtctcaccgtcgacgaa
tttctggcttttctccgcgacgcgcagcaagaagatgttgataccgatcgagcctattgg
gtttcagtttttgacaaatatgttcgaaagtccaagccgcgagcaccaagtctcccagaa
ggtgtggaacgtcaggcttttcgaatgagcctggaagccttctctgcctttctctcatcc
aactggaacggaatatacgcatctcgccctcctcaatcgcgatttgaccgacccctcaat
gagtatttcatttccagctcccataacacgtacctgttgggccgtcaagttgccggcgct
tccagcacagaggcgtatatcagcgctctgtcacagggttgccgatgcgtcgagattgac
tgctgggatggtgccgatggccgcccgatcgtttcgcatggacggacgatgacaaccagt
gttctcttcgccgattgcattaccgtcatcaaccgatacgcattcatcacctgcgacttc
cccctgatcctctcactcgaggttcattgcaatcccgaacagcagctggcgatggtcaag
atcatgaaagacacttttaaggaacgactcgtcctggagccgctcttgacaaatagcttt
gtcctcccatcaccagaagaactgaagggccggattctcgtcaaagtcaaaacatgtgac
gagaccctcgagggagtgcggcaagatacctcgacgacttttgcgagcactggtcggaag
cgcagctcaagttccccatggatgcgtcctagcgtccctgagaatcctttgttcatgaac
cttcctcctctctccagtcctgcgaccattggccaggagagtgtagggccgttcgtttca
caggatagacggtctttcaccaccacaagtatgagcagcgcgacagaagacagcgatggc
gcgttggtgtcagtcaagagagaaaggcgacgtcagaagagcaagatcacgaagcctcta
tcagaccttggagtttacacccgtggctacaaatggcatagtttctcgtctcccgagagt
cagcggttcaaccatgtttactccttcgcggagcgggctttcgagagcatctgccgtgac
gcggagaataaggcgctgttggaaagacataatcaaaaatacctcacgcgagtctatccg
tccgggtttcgtttgcgttcgtccaatttcgatccgctcaagttctggcgacgcggcgtg
caaatggcagccttgaattggcaaacgtacgacatcggaatgcagctgaaccaagccatg
tttgcggctggaactgatcgcactggctacgtcctcaagcccgaagcacttcgtctccca
ccttatgagcaagcgagcacggcgtccaccgaacggaagctggttcggttctcagtggag
gtcatttccgctcaacaacttcctcgaccacgtaccatgggacctgacgacaatatcaac
ccatatgtggaaattgagatgttcagcgcagacgatcgcggccagagttttgtcgtcgga
gaaggaggcatgaatgcttccgcgcggaacggcgtgtcgggcattggctatccgcatcgt
cggcgcacaaagatcgagcagagcaacggatacagcccaactttcaatgatcgtttcaag
ctatcgctcgagaccaagtatccagacctggtgttcgttcgctggactgtttggagctca
ctggatgggcgcagtgctgggaacaacaacagtgttcaattggccactttcactgccaaa
ctgagcagtctgtctcagggttaccgttatctgccactgtacgatctgggcggtgatcaa
tatctgttctccaccctattctgcaaaattaccaaggaggagccggtgccggttcaacga
ctaggcgccgaggaacttcgagccgagcgtctggggatccttcgtcagattggtcaaaca
gtgttcaagcgtggttcatcgacagacagatctgaaaagggtagcgagacgcctgcaagt
ccagacgacaaggatacgtctccggcgttgacgcctactgtttcaacgacgtccacatca
tctctgtttctttga

DBGET integrated database retrieval system