KEGG   Neosartorya fischeri: NFIA_012260Help
Entry
NFIA_012260       CDS       T01070                                 

Definition
1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase 1, putative
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
nfi  Neosartorya fischeri
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:nfi00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:nfi04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1144 aa AA seqDB search
MAYTTTSLPAALNGDAQPSLNINNSLPNPPKLHHVITSFSPATQTSSTTSYMSSLTTTPS
SLFPTSNHSNASSPSGTPLQIAADALRGRLSSFPPVSLSSFELGESMMAVPGNPATSNVD
SAGPNPNKGAGLMRRISRGAASKLTRRRQSATHSDKRDRSSGPVIMRRRSDSKTAAQTGR
ECALDSSNEEDSNDAVDSLGAWCGSEASSLPNDANMMASRNAGAVAPKVDSAIQRGTVLT
KVTKKRKKQVRFFLNLDAGKVYWDLSNPAKRFYIDDIKEVRVGADARNYREEHQVPQDVE
GRWFTIVIADPEKSKGRSVKTLHLIAPNDHILELWTTTLENISQYRINLMAGLAGSGQSE
TVLKAHWQREMSRLFPQGLAPGEEESLDFGAVETVCRSLHINCSKNMLRAQFSKADLGSK
GRLNFSEFQNFVARLKERKDIKDLFKTWAANAQGGLTVDEFLAFLRDAQQEDVDTDRAYW
VSVFDKYVRKSKPRAPSLPEGVERQAFRMSLEAFSAFLSSNWNGIYASRPPQSRFDRPLN
EYFISSSHNTYLLGRQVAGASSTEAYISALSQGCRCVEIDCWDGADGRPIVSHGRTMTTS
VLFADCITVINRYAFITCDFPLILSLEVHCNPEQQLAMVKIMKDTFKERLVLEPLLTNSF
VLPSPEELKGRILVKVKTCDETLEGVRQDTSTTFASTGRKRSSSSPWMRPSVPENPLFMN
LPPLSSPATIGQESVGPFVSQDRRSFTTTSMSSATEDSDGALVSVKRERRRQKSKITKPL
SDLGVYTRGYKWHSFSSPESQRFNHVYSFAERAFESICRDAENKALLERHNQKYLTRVYP
SGFRLRSSNFDPLKFWRRGVQMAALNWQTYDIGMQLNQAMFAAGTDRTGYVLKPEALRLP
PYEQASTASTERKLVRFSVEVISAQQLPRPRTMGPDDNINPYVEIEMFSADDRGQSFVVG
EGGMNASARNGVSGIGYPHRRRTKIEQSNGYSPTFNDRFKLSLETKYPDLVFVRWTVWSS
LDGRSAGNNNSVQLATFTAKLSSLSQGYRYLPLYDLGGDQYLFSTLFCKITKEEPVPVQR
LGAEELRAERLGILRQIGQTVFKRGSSTDRSEKGSETPASPDDKDTSPALTPTVSTTSTS
SLFL
NT seq 3435 nt NT seq  +upstreamnt  +downstreamnt
atggcttatactactacttcgttgcctgcggctctgaatggcgacgctcaacccagttta
aatatcaacaattctctccccaaccctccaaaattacaccatgtcatcacgtctttttcg
cccgcaactcagacctcctcgacaacctcttatatgtcttcgctcacaactactccctca
tctcttttccccacttccaaccattcgaatgcttctagcccttcaggcacaccattacag
atcgctgccgacgcccttcgggggcgtttatcttcttttcctcccgtttcgctttcctct
ttcgaacttggagagtcaatgatggctgtcccaggtaatccggcgacctcaaatgtggac
tctgcgggccccaatccgaataaaggcgctggcctgatgcggagaatatcgagaggcgca
gccagcaagctcacgcgaagaagacaatctgcgactcacagtgataaacgagatcgcagc
tccggtccggtcatcatgcggcgacgcagcgacagtaaaaccgcagctcagaccggacgt
gagtgtgctcttgattctagcaacgaagaagatagcaacgacgcggtggattctctgggt
gcctggtgtggctcggaagcgtccagtctcccgaatgatgccaacatgatggcctcgcgc
aacgcgggcgctgttgcgcccaaagttgattcggcgattcagcgcgggacggtgttgacg
aaagtgactaagaagcgcaagaagcaggtgcgcttcttcctcaaccttgatgcaggcaag
gtttactgggatctgtcaaacccggcgaaacgcttttatattgacgatatcaaggaggtc
cgcgtcggagcggatgcgcgcaactatcgcgaggaacaccaagttcctcaggatgttgaa
ggccgctggttcaccatcgtcattgctgatcctgaaaagtccaagggtcggtccgtcaag
acgttgcacctcattgctcccaatgaccatatccttgaactttggacaacgactctggag
aatatctctcagtatcgaatcaatctcatggctggcttggctgggtccggtcagagtgag
actgtcttaaaagcgcactggcaacgtgaaatgtcaaggctgttccctcagggcttggca
cccggcgaagaagagagccttgacttcggtgccgttgaaacagtttgtcgaagcttgcat
atcaattgttcaaagaacatgcttcgagctcagttctccaaggctgatcttggcagcaag
ggtcgacttaacttttcagagtttcagaactttgtcgctcgtctaaaagaaaggaaagat
atcaaggacctgtttaaaacgtgggccgcgaatgcccagggaggtctcaccgtcgacgaa
tttctggcttttctccgcgacgcgcagcaagaagatgttgataccgatcgagcctattgg
gtttcagtttttgacaaatatgttcgaaagtccaagccgcgagcaccaagtctcccagaa
ggtgtggaacgtcaggcttttcgaatgagcctggaagccttctctgcctttctctcatcc
aactggaacggaatatacgcatctcgccctcctcaatcgcgatttgaccgacccctcaat
gagtatttcatttccagctcccataacacgtacctgttgggccgtcaagttgccggcgct
tccagcacagaggcgtatatcagcgctctgtcacagggttgccgatgcgtcgagattgac
tgctgggatggtgccgatggccgcccgatcgtttcgcatggacggacgatgacaaccagt
gttctcttcgccgattgcattaccgtcatcaaccgatacgcattcatcacctgcgacttc
cccctgatcctctcactcgaggttcattgcaatcccgaacagcagctggcgatggtcaag
atcatgaaagacacttttaaggaacgactcgtcctggagccgctcttgacaaatagcttt
gtcctcccatcaccagaagaactgaagggccggattctcgtcaaagtcaaaacatgtgac
gagaccctcgagggagtgcggcaagatacctcgacgacttttgcgagcactggtcggaag
cgcagctcaagttccccatggatgcgtcctagcgtccctgagaatcctttgttcatgaac
cttcctcctctctccagtcctgcgaccattggccaggagagtgtagggccgttcgtttca
caggatagacggtctttcaccaccacaagtatgagcagcgcgacagaagacagcgatggc
gcgttggtgtcagtcaagagagaaaggcgacgtcagaagagcaagatcacgaagcctcta
tcagaccttggagtttacacccgtggctacaaatggcatagtttctcgtctcccgagagt
cagcggttcaaccatgtttactccttcgcggagcgggctttcgagagcatctgccgtgac
gcggagaataaggcgctgttggaaagacataatcaaaaatacctcacgcgagtctatccg
tccgggtttcgtttgcgttcgtccaatttcgatccgctcaagttctggcgacgcggcgtg
caaatggcagccttgaattggcaaacgtacgacatcggaatgcagctgaaccaagccatg
tttgcggctggaactgatcgcactggctacgtcctcaagcccgaagcacttcgtctccca
ccttatgagcaagcgagcacggcgtccaccgaacggaagctggttcggttctcagtggag
gtcatttccgctcaacaacttcctcgaccacgtaccatgggacctgacgacaatatcaac
ccatatgtggaaattgagatgttcagcgcagacgatcgcggccagagttttgtcgtcgga
gaaggaggcatgaatgcttccgcgcggaacggcgtgtcgggcattggctatccgcatcgt
cggcgcacaaagatcgagcagagcaacggatacagcccaactttcaatgatcgtttcaag
ctatcgctcgagaccaagtatccagacctggtgttcgttcgctggactgtttggagctca
ctggatgggcgcagtgctgggaacaacaacagtgttcaattggccactttcactgccaaa
ctgagcagtctgtctcagggttaccgttatctgccactgtacgatctgggcggtgatcaa
tatctgttctccaccctattctgcaaaattaccaaggaggagccggtgccggttcaacga
ctaggcgccgaggaacttcgagccgagcgtctggggatccttcgtcagattggtcaaaca
gtgttcaagcgtggttcatcgacagacagatctgaaaagggtagcgagacgcctgcaagt
ccagacgacaaggatacgtctccggcgttgacgcctactgtttcaacgacgtccacatca
tctctgtttctttga

DBGET integrated database retrieval system