KEGG   Neosartorya fischeri: NFIA_012610Help
Entry
NFIA_012610       CDS       T01070                                 

Definition
MAP kinase SakA
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
nfi  Neosartorya fischeri
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    NFIA_012610
Enzymes [BR:nfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     NFIA_012610
Protein kinases [BR:nfi01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   NFIA_012610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 366 aa AA seqDB search
MAEFVRAQIFGTTFEITSRYTDLQPVGMGAFGLVCSARDQLTGQPVAVKKIMKPFSTPVL
SKRTYRELKLLKHLRHENIISLSDIFISPLEDIYFVTELLGTDLHRLLTSRPLEKQFIQY
FLYQILRGLKYVHSAGVVHRDLKPSNILINENCDLKICDFGLARIQDPQMTGYVSTRYYR
APEIMLTWQKYDVEVDIWSAGCIFAEMLEGKPLFPGKDHVNQFSIITELLGTPPDDVIQT
ICSENTLRFVKSLPKRERQPLANKFKNADPEAVDLLERMLVFDPKKRIRAGEALAHEYLT
PYHDPTDEPEAEEKFDWSFNDADLPVDTWKIMMYSEILDFHNIDQGNDAGQVLMEGGVAQ
AHQNYA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggccgagttcgtgcgtgcccagattttcggcaccaccttcgagatcaccagcaggtat
acggatctgcaaccggtgggaatgggcgcctttggacttgtctgctccgcaagagatcaa
ttgacaggccaacccgtggctgtaaagaagatcatgaagcctttcagcactcctgttttg
tcgaagagaacataccgtgagctgaagctgttgaagcatttacggcatgagaacatcatt
agcttaagcgatatcttcatctcccctctcgaggacatttactttgtcacagagctcctt
gggaccgacctccaccgacttttgacttcgagaccattggagaaacagtttattcaatac
ttcttatatcagattttgcgaggtctgaaatacgttcactcagcaggcgtcgtccaccgt
gatctcaaacccagcaacatccttatcaacgaaaactgcgacctgaaaatttgcgatttt
ggccttgctcgtatccaagaccctcagatgaccggctatgtttcgacgagatactaccga
gcccctgaaatcatgcttacatggcagaaatatgatgtggaagtcgacatatggagtgca
ggctgtatttttgccgagatgctggaaggaaagcctttattccccgggaaggaccatgtc
aaccagttctctatcatcacagaactgctcggaactccgccggacgatgtgattcaaact
atctgcagtgagaataccctgcgatttgtcaagtccctaccgaagcgtgaacgccaacct
cttgccaacaaattcaagaacgctgatcctgaggcggtcgatcttctagagcgaatgctc
gtttttgatcccaagaagaggatccgcgccggggaagcacttgcgcacgaatacctcact
ccctaccacgaccctaccgatgagccggaggctgaggagaagttcgattggtcgttcaat
gacgccgaccttcccgtggacacctggaagattatgatgtactcggagattctcgacttc
cacaacattgaccagggtaacgacgctggccaggtgctcatggaaggaggcgtggctcaa
gctcaccagaactatgcctaa

DBGET integrated database retrieval system