KEGG   Neosartorya fischeri: NFIA_014650Help
Entry
NFIA_014650       CDS       T01070                                 

Definition
sphingosine kinase (SphK), putative
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
nfi  Neosartorya fischeri
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    NFIA_014650
Enzymes [BR:nfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     NFIA_014650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 486 aa AA seqDB search
MASPDGATRPSFNADQPDSHSQLLQPDSTLTVGQSITLTLGSDALVIAETKETQSIALYN
ILHAEVSSAGLTITYADPVTKHDVTVGALQYTIADEDKAKAETFTARLLDLAYGNAQRYK
KFKVLINPFGGKGIASRLYHQYAAPILAAAHCVVEVEETTHGGHATEIAEQIDIDAYDAI
VCCSGDGLPYEVFNGLAKKPNAREALSKLAVAMIPGGSGNAMAWNLCGTGSASVAALAIV
KGVRTPMDLVSVTQGKTRTLSFLSQSFGIIAESDLGTDNIRWMGAHRFTYGFLVRLMQRT
VWPCDLAIKVEIDDKNAIKEHYRKYVAGEPPRRQSEDTVAGSGGLPDLKYGTVLDELPQD
WEVVPGENMGNFYAGNMAIMSADTNFFPASLPNDGLIDVVTIDGTISRLTSLKMMTEVPE
GGFFDMPDVKIRKASAYRLTPREKEGYISVDGERVPFEPFQVEVHRGLGTVLSKSGHLYE
AEGPRP
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggcttctcccgacggcgctactcgcccttccttcaatgcggatcagccggattcccac
tctcagttactccaacccgactcgaccttgacagtcggacagtcaattaccttgactttg
ggtagcgatgcgcttgttattgctgagaccaaagaaactcaatctatcgcattgtacaat
atccttcatgcagaagtctcctcggcaggtctgaccattacatatgcggaccctgtaacc
aagcacgatgttaccgttggtgctttgcaatacaccattgcagacgaagacaaagcaaag
gccgaaacattcacggccaggctacttgatctggcatacggtaatgcccagcgctacaag
aaattcaaggtcctgatcaacccgtttggtgggaagggtattgcctcgcgattgtatcat
caatacgcggcgccgatccttgctgctgcgcattgcgtagtggaagtagaagaaacaacg
catgggggacacgccaccgagatagcggaacagattgacatagacgcatacgatgcaatt
gtatgctgctctggtgatggattgccctacgaggtcttcaatggtctggccaagaaacct
aatgctcgtgaggcgctatctaagctcgctgtcgccatgatacctggtggttcggggaac
gccatggcttggaacctttgcgggacaggtagtgcctctgttgctgcgctggcaattgtc
aaaggtgtaaggactcccatggatctggtctccgtcacgcagggcaaaactcgaaccctg
tctttcctgtcgcaatctttcggtatcatcgcagaatctgacttaggaaccgataatatc
cggtggatgggtgcccaccgcttcacctacggtttcttggtccgtctcatgcaacgcaca
gtgtggccatgtgacctagcgataaaagtggagatcgatgacaagaacgcgataaaggag
cattacagaaagtacgtggccggagaacctccccgccgccagtctgaagacaccgtcgcc
ggatcgggagggctccccgacttgaagtacggcacggtcttggatgagctcccgcaggac
tgggaagtcgtcccgggtgagaacatgggcaatttctacgcgggcaatatggccattatg
tccgcagacacgaacttctttccggcttctctgccgaatgacggtctgattgatgttgtc
acaattgatggaaccatcagccgcctcacatcgctcaaaatgatgacagaggtccctgag
ggaggattttttgatatgccggatgttaagattcgtaaggcttcggcatatcgactcact
ccccgggagaaagagggctacatcagtgtcgatggtgaacgtgtgccctttgagccgttc
caagtcgaagttcatcgtggtctaggtacggtgttgtcgaagtccggacacctttacgag
gccgagggccctcggccatga

DBGET integrated database retrieval system