KEGG   Neosartorya fischeri: NFIA_016620Help
Entry
NFIA_016620       CDS       T01070                                 

Definition
nuclear pore complex protein (SonA), putative
Orthology
K14298  
mRNA export factor
Organism
nfi  Neosartorya fischeri
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    NFIA_016620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 363 aa AA seqDB search
MSLFGNVGATSTTAGQTNTTGDISKDVPLSSPPEDGISDLRFSPASEHLAVASWDKKVRI
YEINEQGQSEGKALFEHEAPVLNCCWSPDGTKVVGAGADKAARMLDLAANATTPVQVAAH
DAPIRCCHMIPNPAGNSSLLVTGSWDKTVKYWDLRQSTPIATVECQERVYTMDVKNKLLV
VGTADRYINIINLDNPTKFYKTMQSPLKWQTRVVSCFTDATGFAVGSIEGRCAIQYVEDK
DSSSNFSFKCHRETPPNQRDINNIYSVNAISFHPVHGTFSTAGSDGTFHFWDKDAKHRLK
GYPSVGGTISSTAFNRNGNIFAYAVSYDWSKGYSANTQQLPNKVMLHPVAPEEVKPRPGT
RKR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcttcgggaacgtcggcgctacgtcgacaacagctggtcaaacaaacaccaca
ggcgatatctccaaagatgtaccgcttagctcgccgcccgaagatggcatctctgatctt
cggttttctcccgcaagcgaacatctcgcggtagcttcatgggacaagaaggtccgcatc
tacgagatcaacgaacagggtcagagtgaagggaaagctcttttcgagcatgaagctcca
gtcttaaattgttgctggtcaccggatggaacgaaagttgtcggagcaggcgccgacaaa
gctgcacgcatgctggacctcgcagccaacgctactactcccgttcaagtcgctgcccac
gatgctcctatccggtgctgtcatatgattcccaacccggctggaaactcttctcttctt
gtgactggttcatgggacaagaccgtcaaatactgggacctgcggcaatctacccctatt
gcgacggtggagtgccaggagcgcgtctacaccatggatgtcaagaacaagctactagtg
gtgggaacggcagaccgctacattaacatcatcaatcttgacaatcccaccaagttctat
aagaccatgcagtcaccactcaagtggcagacgcgggtagtcagctgctttacggatgcc
actggtttcgctgtcggtagtattgaaggacgttgcgccattcaatatgttgaggacaag
gactctagctccaacttcagcttcaagtgtcatcgcgaaacccctccaaaccaacgagat
atcaacaacatttactcggtgaatgctatttccttccatccggtccacggcaccttcagc
accgcaggtagtgacggtaccttccatttctgggacaaggatgccaagcatcgtttgaag
ggatacccttctgtgggaggcacgatctccagcaccgccttcaaccgcaatggcaatatc
tttgcatatgccgtcagctacgattggagtaaaggatattcagcgaacacgcaacaactt
cccaacaaggtgatgctccatccagtagcgccagaggaggtgaagccaagacctggtacc
cggaagaggtag

DBGET integrated database retrieval system