KEGG   Aspergillus fischeri: NFIA_016820Help
Entry
NFIA_016820       CDS       T01070                                 

Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00230  Purine metabolism
nfi01100  Metabolic pathways
Module
nfi_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NFIA_016820
Enzymes [BR:nfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     NFIA_016820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_33 AAA_18 AAA_24 AAA_22 MMR_HSR1 ABC_tran AAA_28 RsgA_GTPase RNA_helicase AAA_29 AAA AAA_14 NACHT AAA_5 DUF2075 T2SSE Transcrip_act AAA_30 cobW ATPase_2 NTPase_1 AAA_19 Bac_DnaA
Motif
Other DBs
NCBI-GeneID: 4591493
NCBI-ProteinID: XP_001264883
UniProt: A1D3J3
AA seq 228 aa AA seqDB search
MLRLFSSRTAGKLTDTRPSLISWYSSLTMATGAAQRFRPVVVSGPSGTGKSTLLKRLFAE
YPDTFDLSVSHTTRAPRPGEVNGREYYFTTKEDFLDLVSKNAFIEHAQFGGNYYGTTVQA
VKDVAQKGKICVLDIEMEGVKQVKRTDLDARFLFLAPPSIEELEKRLRGRATETEESLTK
RLAQAKNELEYAAQPGSHDKTVVNDDLEKAYRELRDWIVDGGNFGARQ
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgcctattcagctctcgtacagctgggaagttgactgatacacgcccctctttg
atttcttggtactccagcttgacaatggctaccggggctgcgcaaaggttccgtccagtg
gtggtatcgggtccctctgggactggaaagtctactttgctcaagagacttttcgctgaa
taccccgatactttcgatttatcagtgtctcataccactcgagctccccgtcccggggaa
gtaaatggacgcgagtattacttcacaactaaagaagatttcctggatctcgtgagcaag
aatgcctttatcgagcatgcgcagtttggcggcaattactacggcactactgtgcaggca
gtgaaggatgttgcgcagaagggcaagatctgcgttctcgacattgagatggagggcgtg
aagcaagtcaagcgcaccgatcttgatgcccgattcttatttctagcgcccccgtccatt
gaagaactagagaaaagactgcgtgggagagcaaccgagactgaggagagcttgacgaaa
cgccttgcccaagctaaaaacgaattggaatatgctgcgcagcctggctctcatgataag
accgtcgtgaacgatgacctagagaaggcctatagggagctgcgggattggattgtcgac
ggtggtaactttggagcgcgtcaatga

DBGET integrated database retrieval system