KEGG   Neosartorya fischeri: NFIA_016960Help
Entry
NFIA_016960       CDS       T01070                                 

Definition
porphobilinogen synthase, putative
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
nfi  Neosartorya fischeri
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NFIA_016960
Enzymes [BR:nfi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     NFIA_016960
Exosome [BR:nfi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NFIA_016960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 373 aa AA seqDB search
MSFSNLVSDLAFRDAYDDRSSQISHARSQATARSYTSTAATSVSISGDISSQLHAGYSHP
LTRSWQAERQLTKEMLIYPLFITDNPDEETPIPSLPNQHRRGLNRLVPFLRPLVQKGLRS
VILFGVPLHPTAKDALGTAADDPSGPVIQAIRLLRSRFPNLYIVTDVCLCEYTSHGHCGI
LREDGTLDNSQSVDRISDVALAYATAGAHCVAPSDMNDGRVRAIKLKLIEAGLAHRVLLM
SYSAKFSGCLYGPFRDAAGSCPSFGDRRCYQLPPGGRGLARRAIQRDVGEGADIIMVKPA
SSYLDIIRDAKELAKDMPIAAYQVSGEYAMIHAAAKAGVFDLKSMAFESTEGILRAGAGI
IVSYFVPEFLDWL
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgtctttctcaaatcttgtgtcggatctcgcctttagggatgcttatgatgatcgcagc
tctcaaatatcccatgcacggtctcaggccaccgctcggtcatacacaagcacagctgct
acaagtgtcagcatttctggagacatttcaagccagctgcatgctggatatagccatcca
ttgaccaggtcatggcaagctgaaagacaattgaccaaggaaatgctcatctatccatta
ttcatcactgacaatcccgatgaagagacaccaataccatcactgcctaaccagcatcgc
cgaggtctgaaccgccttgttcctttcctcaggccacttgttcaaaagggactgcggtcg
gttattttgtttggggttccactacacccgaccgcaaaggatgccctgggtactgctgcg
gacgatccttcgggcccggtcattcaggccatccgtcttctcaggtcacgctttcctaat
ctctatattgtgactgacgtttgtctctgcgaatacacatctcatggtcactgcggtata
ctacgagaggatggaacgctggataactcccagtctgttgatcgaatttcagatgtcgcc
cttgcctacgctactgctggtgcgcactgcgtcgctccatccgacatgaatgatgggaga
gttcgcgctatcaaactaaagttgattgaagcaggcttagcccatcgtgttctcttgatg
tcttacagcgcaaagttcagtggttgtctctatggaccattccgtgacgcagccggttct
tgcccgtctttcggtgaccgcagatgttatcagctgccgccgggaggccgtggactcgcc
cggcgagcaattcaacgagatgtgggtgaaggcgcagacatcataatggtgaagcctgca
agtagttatctggatatcatcagggatgcaaaggagcttgcaaaggatatgccaattgca
gcgtaccaggtcagtggtgagtatgctatgatccatgccgctgccaaggccggggtgttt
gatttgaaatcgatggcgtttgaaagtacggaagggattctcagagccggcgctggaatt
atcgtgagctatttcgtaccagaatttttggactggctttag

DBGET integrated database retrieval system