KEGG   Neosartorya fischeri: NFIA_017040Help
Entry
NFIA_017040       CDS       T01070                                 

Definition
protein O-mannosyl transferase
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
nfi  Neosartorya fischeri
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    NFIA_017040
Enzymes [BR:nfi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     NFIA_017040
Glycosyltransferases [BR:nfi01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   NFIA_017040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 748 aa AA seqDB search
MRPSTTAEMDVASTTGANVGSDLRRRNVHAGEKVDKLFSSHNLEDKDAKSRPKPSSFSSI
LYSWEPFIVPIVLTALAVFTRMYRIGRSNIVTWDEAHFGKFGSHYLKREFYFDVHPPLGK
MLVGLSGLLAGYNGSFEFKSGEKYPDDVNFTFMRVFNAAFGVACVPLAYYTARELGFRKA
TVWLISLMVLFENSYATISRFILLDSMLLCFTFTTTMCWAKFHRLQHASFSGQWFTWLFL
TGISIGCVCSVKWVGLFCTALVGLYTIEDLWNKFGDLRMPKTVLVNHLLARVVGLIIIPA
VVYMLSFYVHFWILENSGPGDAQMSSLFQANLKGTEVGKDSPLEIALGSRVTLKNMGYGG
GLLHSHVQTYPDGSNQQQVTCYHHKDANNDWFIYPNRHEPEYDANGPLSFVGDGDIIRLI
HGQTGRNLHSHAIPAPITKSQYEVSCYGNITIGDEKDHWAVEVVDDVASRDRSRIRTLTT
AFRLRHIVLGCYLRAGNVNLPQWGFKQIETTCVKENNPRDVYTHWNVESHFNDRLPPGDP
GSYKSPFFKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPILNVGLRMCSWDDNTIK
YYLLGNPFVYWGSTVSLGVFGLLIFWYLARWQRGYKDLNQADIDHIHYSGFYPLLGWILH
YFPFIIMARVTYVHHYYPALYYAILTFGFCVDWLTQKMSPVARGSLYAFLYMVIIGMFVH
FRVIVFGIEGPSQQWANLNWLSGWRIAN
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgagaccatccaccacggcggaaatggatgtcgcatcaactaccggtgccaatgtcggc
tccgatttgcggcgtaggaatgttcacgccggagagaaagttgataagctcttctcatct
cataatctcgaggacaaggacgcaaagtcgaggcctaagcccagttctttctcctcaata
ctatatagttgggaacctttcattgtgccgattgtgctgacagccttggctgttttcacc
cgtatgtaccgcataggtcgctcgaacattgtgacatgggatgaagcccactttgggaaa
ttcggttcacattacttgaagcgagaattctactttgatgttcacccgccactgggaaag
atgcttgttggcttatccggtctccttgctggatacaacggatcctttgaattcaaatca
ggagagaaatacccagacgatgtcaactttacattcatgcgtgtcttcaacgccgctttc
ggtgttgcgtgcgttcctctcgcttattacactgctcgagagctaggtttccgcaaggcc
accgtttggctaatcagtctgatggttttgttcgaaaactcctacgcgaccatttcaagg
ttcatattgcttgactcgatgttactttgcttcacctttacgaccaccatgtgctgggct
aagtttcatcggttacagcatgctagcttctcaggtcagtggttcacgtggctcttcctg
acaggtataagtatcggctgcgtatgcagtgtcaaatgggtgggtcttttttgcacagca
ttagtgggactctatacaattgaagatttgtggaataaatttggcgatcttaggatgccg
aagacagtcctcgtcaatcacctactggctcgcgtagtcggattgattattataccagct
gtggtatatatgctttccttttacgtgcatttctggattcttgaaaacagtggaccgggc
gacgcgcagatgagctctctctttcaggccaacctaaagggcaccgaagtcggaaaggac
agccctctcgaaattgcgcttggctctagggtcactttaaaaaatatgggttatggtgga
ggactgctgcattctcatgttcaaacttatcccgacggttccaatcagcagcaggtcact
tgttaccatcacaaggacgcaaacaacgattggttcatctaccccaaccgccatgaacct
gagtatgacgccaacggacctctgtcttttgttggtgatggcgatattattcgtcttatt
catgggcaaacgggccgaaaccttcattcgcatgccatcccggctcctatcaccaaatct
caatacgaagtctcctgctatggtaacatcactattggggacgaaaaagatcactgggca
gtggaggttgtcgatgatgtcgcgtcaagggaccgaagcaggattcgaaccctgacaact
gcattccgcctgagacacatcgttctgggctgctatctgcgcgccggcaacgtgaacctc
ccacagtggggttttaagcagatcgagaccacatgcgttaaagagaacaatcctcgcgac
gtctacacgcattggaacgtggagtctcatttcaatgatcgacttccacctggtgatcca
ggatcgtacaagtcccccttttttaaggatttcattcatctgaatgtcgccatgatgaca
tcgaacaacgcgcttgttcctgatccagacaaacaagatgaccttgcgtcgaaattctgg
caatggccaatacttaatgtgggccttcgtatgtgctcctgggatgacaacaccattaag
tattatctcctcggaaatccctttgtctactggggcagtacagtcagtctcggggttttt
ggactcttaatattctggtatctggcccgctggcagcggggttacaaggatctcaaccaa
gcggacatcgatcacatccattattccggcttctatcctctgctcggatggatcctacac
tacttccctttcataatcatggctcgggtgacctatgttcaccattattaccctgcgctc
tattatgccatacttaccttcggtttttgtgtcgactggcttactcaaaaaatgagtcct
gtggctcgtgggtctctgtatgccttcctttacatggtcatcatcgggatgtttgttcat
ttccgggtcatcgtgttcggcattgagggacctagccagcaatgggccaatctgaactgg
ctgagcggttggcggattgcgaattga

DBGET integrated database retrieval system