KEGG   Neosartorya fischeri: NFIA_017560Help
Entry
NFIA_017560       CDS       T01070                                 

Definition
ubiquitin C-terminal hydrolase, putative
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
nfi  Neosartorya fischeri
Brite
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     NFIA_017560
Peptidases [BR:nfi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   NFIA_017560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 863 aa AA seqDB search
MPHGQPPMPPPRRQQDLPYAGGPPNMRSPPTYMGYHPHMNGHPPPAYSPQQYGHWYPAYP
QMQLPPRPFQPPYAPMIVSSYPHSPPVMAPSHMPPPSLAMQPRAATPLQSTMSPPVGPVP
VPLNMQAQSPADIPVHFTPSPVVSSPSASAPVIPAAPAPSEPFRAPLPWLSVPDRPFPAR
TPHRRRKGRSLQISSVSVELPSKEPQLAKQGEKLDEEKPVEQTVQEQSEPQTPSLSAAPS
VADSTQPTTPSSAVASTAARSQSHSKGSKPAVPVVPVLPVIPGPVAHQRQPPKDDVSRVP
ETPKTATASVASANETPKEDAAEETAKAASPPRTAPKSWADLVRAKGASRVSGPAGAHSI
ESNGLVMRKSESLADVLTSLGEDVSQYSDKIAFLEPRGLINTGNMCYMNSVLQILVSCIP
FYQFLDHVGRRASHSVQSAFPMVDAMIMFMKEFRVIDAAPSEEQLRLRLKPNELEEYGEA
FTPDFVYEVIRQLSRFRDMQRGHQQDAQEFLGFLLEEMHEECVRAAKNASTTKPAASTTA
ESIDKEEQSGDGWLEVGHKQKAAVTRSSGHIAQESPITRIFGGKIRSEFKVPGNKTSVTL
EPYQPLQLDIGSPDINNIVDALKGLTKPESIQGDFNSSRGPNVTATKQIFIENLPPVLIL
HLKRFQYDSVTRGTQKIWKKIGYPLDLEIPREVFAPNKRNIMMAHGGLPKYRLIGVIYHH
GRNASGGHYTVDVRRQDGREWIRLDDTVIRRIKSEDVAEVGGEEDPKVLAAALEQHKRDN
TSNANIFGHIDQDDQELSDNERGWSQVNGTSTGGHSSKKSTPAVLNGASAAASGSSSGVR
TPIGRYGSRDNKVAYLLFYQRVA
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atgccccatgggcagccacccatgccgcctcctcgacgacaacaagatctgccttatgct
ggagggccgccgaacatgcgctctccgccaacctatatgggttatcaccctcacatgaac
ggccatccacctcctgcttactcaccgcaacaatatggtcattggtatccagcatatcct
cagatgcaacttcctcctcgaccatttcagcctccatatgcgccaatgattgtctcttcg
taccctcattcgccgcctgtgatggctccatctcacatgccacccccatcgcttgcaatg
cagcctagagccgcgactcctcttcaatctaccatgtctccgcccgtcggaccggtgcct
gtcccattaaacatgcaggctcagtctcctgcggatattcctgttcatttcacacccagt
cctgttgtgtcttcgccatctgcttcagcgcctgtgatacctgctgcccctgctccgagt
gagcctttccgtgctccgttgccttggctctcggtacccgatcgtcctttccctgccagg
acccctcacagacgtcgaaagggtcgcagtttacaaatttcatctgtctcggtcgagctg
ccttcaaaggaaccgcaactagctaagcagggagagaaactagatgaagagaagccggtc
gaacagactgtgcaagaacaatcagaaccccagactccatccctatccgctgctccttcg
gttgcggattcgacccagcccacgacaccgtcttcagctgttgcctccacagcggcccgc
tctcagtcacactcgaaaggatcaaaacccgccgttcctgtggtgcctgttttgcccgtc
atcccaggccctgtagcccaccaacggcagccacctaaagacgacgtgagtcgtgtacct
gagactcctaaaacagcaacagcctctgttgcctcagcgaacgagacaccaaaagaagat
gccgctgaagagacagccaaggcggcttcgcctcctcgtactgcccctaagtcttgggcc
gaccttgttcgagcaaaaggagcgtcgagagtctcgggcccagccggcgctcactcgatc
gagtctaacggcctggtcatgcgcaagagcgaatctctagcagacgttctaaccagtctt
ggggaggacgtttctcagtacagcgacaaaatcgcctttcttgaaccaagagggcttata
aatactgggaatatgtgctacatgaactcggtccttcaaattctggtctcctgcataccg
ttctatcaattcctggatcatgtcggcagacgagcatcacatagcgtccagagcgcattt
cctatggttgacgctatgatcatgttcatgaaagaattccgtgtcatcgatgctgctcct
tcggaagaacagttaaggcttcggctgaaacctaatgagctcgaagaatatggcgaagct
tttaccccggactttgtatacgaagtgattcgacaattatctcgattccgggacatgcaa
cgaggtcaccagcaggatgctcaagaattcctgggattccttctcgaggaaatgcacgaa
gaatgcgttcgagctgcgaaaaacgcgagcacgacaaaacctgcggcttcaacaaccgct
gaatcgattgataaagaggagcagtctggcgatgggtggctagaagtcggacacaaacaa
aaggctgcagtcacacgctcttccggtcacattgcgcaggagtcccctatcaccaggata
ttcggtggcaagatcagatcggagttcaaggtaccgggcaacaagacttccgtgaccttg
gagccttatcagcctctgcagctcgacattggctcccctgatatcaacaatatcgtcgac
gctctgaaaggcctaaccaagccggagagcatccaaggtgactttaactcttctcgtggt
cccaatgtcactgccaccaagcagatattcattgagaatctgccacctgtcctcattctc
catctgaagcggttccagtatgacagcgtgaccagaggtacacagaagatatggaagaag
attgggtatcccttggaccttgaaattccccgagaggtcttcgctccgaacaaacgcaat
attatgatggctcatggtggtttgcccaaataccgcctcattggtgtcatctatcaccat
ggcagaaacgctagcggcgggcattatacggtagatgtacgccgtcaagacggtcgcgag
tggattcgcctcgacgatacggttattcgccggatcaaaagcgaggatgtcgcggaagtt
ggcggcgaggaagatccgaaggtgctcgctgccgcgctcgagcaacacaagcgagacaat
acctccaacgctaacatctttggtcatattgaccaggatgatcaggagctgtctgacaat
gaaaggggctggagtcaagtgaatggaacaagcacgggaggccattcgagcaagaagtcc
acccccgccgttttgaacggggcctctgccgctgcctcgggaagttcttccggagtcagg
actcccatcggccgatatgggtctcgtgacaacaaagtggcatatcttctcttctatcaa
cgtgttgcttga

DBGET integrated database retrieval system