KEGG   Neosartorya fischeri: NFIA_018920Help
Entry
NFIA_018920       CDS       T01070                                 

Definition
MAP kinase kinase (Mkk2), putative
Orthology
K08294  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
nfi  Neosartorya fischeri
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    NFIA_018920
Enzymes [BR:nfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     NFIA_018920
Protein kinases [BR:nfi01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   NFIA_018920
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 504 aa AA seqDB search
MSSSPVPLLRPPVPGNRSNGPRPPKLTLGIPPSPNSRPVDGNGAGPAAAAAPEAPQPQRP
STRPAPPQLRLATPMGSSSDVPQEVPRLANGRPAPPPLATTGLNESNGHSRSSSFTYLDG
KASGPASASSSNYSALSFAMGLRQPHGSTPDPSSAISSVYSDREGGVQMERDNSVNGLLP
DLDKLSLEKGRPLDVDDLDDEGWLAASEQKKIIELGSLGEGAGGAVTRCKLKDGKTVFAL
KIITTDPNPDVKKQIVRELNFNKDCASEHICRYYGAFMDKSTGTISIAMEFCEGGSLDSI
YKEVKKLGGRTGEKVLGKIAEGVLNGLTYLHSRKIIHRDIKPSNILLCRNGQVKLCDFGV
SGEFGTKGDANTFIGTSYYMAPERITGQSYTITSDVWSLGVTLLEVAQHRFPFPADGTEM
QPRAGLIDLLTYIVRQPIPKLKDEPENRIRWSDNFKYFIECCLEKEPPRRATPWRMLEHP
WMLDMKNKKVNMANFVRQVWGWQD
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcctcgcccgttcctctcctcagaccaccagtgcctggcaatcgcagcaacgga
cctcgacctccaaaactcacgctgggcattcctccatccccgaacagcagacccgtcgac
gggaatggcgccggccccgcagccgcagcagcccccgaagctccccagcctcagcgacct
tctactcgtcccgctcctcctcagctgcgactcgcgacccccatgggcagcagctcggat
gtgccccaggaagtgcctcgactggcgaatggcagaccagcccctccgcctctggcgacc
acggggttgaacgaatcgaacggacattcgaggtccagcagttttacgtatctggatgga
aaagctagcggtccggcgtccgcatcatcgtcgaattactctgcactctcattcgccatg
ggtctccggcaaccgcacggcagcactccagatccctcgtctgcgatcagctcggtatac
tccgacagggagggaggtgtgcagatggagcgcgataacagcgtcaacggacttcttccc
gatttggataagttgagtctggaaaagggcaggcccctggacgttgatgatttggatgat
gaaggttggctggctgcaagtgagcaaaagaagattattgagttgggtagtctgggtgag
ggcgctggtggtgccgttacacggtgcaagctgaaggacggcaagaccgtttttgccctg
aagatcatcacgaccgacccaaacccagatgtgaagaagcagatcgttcgagaactcaac
ttcaacaaagactgtgcgtcggagcacatctgccgctactacggcgctttcatggacaag
tcgacaggaacaatctcaattgcgatggagttttgcgaaggaggaagtttggacagcatt
tacaaggaggtcaagaaactggggggccgaacaggagaaaaagtactcggcaaaatcgct
gaaggtgtcttgaatggtttgacatacctacatagcaggaagattatccatcgagatatc
aaaccctcaaacattctcctgtgtcgaaacggccaagtgaagctctgtgactttggcgtc
agcggcgaatttgggaccaagggagacgccaacacattcatcggcacatcgtactatatg
gctcccgaacgaataaccggccaatcctataccattacatctgacgtttggtcccttggt
gtgacgctgctggaggttgcccagcatcgtttcccgttccctgccgatggcaccgagatg
cagccaagagccggattgatagatcttcttacatacatcgttcgccaacccattcccaag
ctgaaagatgagcccgaaaaccgtatccgctggtccgataacttcaagtactttattgaa
tgctgtctcgaaaaggaacctccacgaagagctacaccatggcggatgctggaacatccc
tggatgctggacatgaaaaataaaaaggtcaacatggccaacttcgtccggcaggtgtgg
ggctggcaggattga

DBGET integrated database retrieval system