KEGG   Neosartorya fischeri: NFIA_019290Help
Entry
NFIA_019290       CDS       T01070                                 

Definition
3-oxo-5-alpha-steroid 4-dehydrogenase, putative
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
nfi  Neosartorya fischeri
Brite
Enzymes [BR:nfi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     NFIA_019290
    1.3.1.94  polyprenol reductase
     NFIA_019290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 324 aa AA seqDB search
MELIRKLVDTTLSVTHMDVVDALRAFFIFAACTILSISLPDTLRGRFVTYGARATSTTVG
SRPLAPADGSDNSRVHLALDYLASLRVPHSYFTHFYVASVLSSLFWAFQLLSRGSAFQAI
ATRIGPQHLEKSMSIHQVLLCWALMLVQGIRRLHESRIFFKPSSSRMWFVHWLLGLAFYL
AATVAIWIEGTETLMTHKLTLDDVQVATAPTLRTFLCLPLFLIASGVQHDCHHYLFSLKK
YTLPTHPMFQRIVCPHYTAECVIYLSLALLAAPNGEMVNKTVLSCFTFVTVNLGVTAAIS
KRWYKQKFGPDAVKERWNMIPGLF
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggagcttatcaggaagcttgtggacacgacgctttccgtcacgcacatggacgttgtt
gatgctcttcgagctttctttatctttgcagcctgcacgatactgtcgatcagcctgcca
gatacacttcgcggccgtttcgtgacttatggtgctcgtgcaacatcaacaacggtcggg
tcgagaccccttgcgcctgccgatggctcggacaactctcgcgtacacctcgcactcgat
tacctcgcctctctgagagttcctcacagctacttcacgcacttttatgttgcctctgtg
ctttcttcgctcttttgggcgttccaattgctatccagaggttcggcgtttcaagccatt
gcgacaaggataggcccacaacacttggagaagtcgatgtccatacatcaagtcttacta
tgctgggcattgatgttagtacaaggaattcggcgactgcatgagagtcgcatctttttc
aagccatcctcgtccaggatgtggtttgtccattggcttctagggctcgccttttacctc
gctgcaacggtcgccatctggattgaggggacagaaactctcatgacccacaagttgact
ctcgatgatgttcaagtagccaccgctcctactcttcgcacattcctctgccttccatta
tttttgatcgcctcgggtgttcagcacgattgtcaccactacctcttctcgcttaagaag
tataccctcccgactcatcctatgtttcaaagaatcgtatgtccccattacacggccgag
tgcgtgatatacctgtcgttggctctgctggctgcaccgaatggcgagatggtgaacaag
acagttttgtcatgtttcacgtttgtaacggtgaatttgggtgtaaccgccgcaatcagc
aagcgatggtacaagcagaagttcggaccggacgctgtcaaggaaagatggaacatgatt
cctggactcttctaa

DBGET integrated database retrieval system