KEGG   Neosartorya fischeri: NFIA_022510Help
Entry
NFIA_022510       CDS       T01070                                 

Definition
amylo-alpha-1,6-glucosidase, putative
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
nfi  Neosartorya fischeri
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NFIA_022510
Enzymes [BR:nfi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     NFIA_022510
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     NFIA_022510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1537 aa AA seqDB search
MASPQQVYLLPLKDDGSPDVPGGYIYLPPPSNPAYLLRFVIEGSSSICREGTLWVNIPET
GKPFDRSVFRSFRLEPDFNKNIQIDIPVTCPGSFLFHTTFTPLPQFSVGPVPTPEPARTP
DYYVDVAPRLTLRGKDLPLNALSIFSVLSKFMGKYPTDWDRHLNGISQRNYNMVHFTPLM
KRGASNSPYSIFDQLQFDDGAFPNGEVDVAQMISKMEKEYGLLSLTDVVWNHTAHNSKWL
EEHPEAGYSVETAPWLEAALELDTALLKFGQDLEKLGLPTEFKTVDDLLAVMTALREKVI
SGIRLWEYYVIDVKANAGHILENWKASGLKHSASKKYAEVDIGGFKDWPLKQQADLVRQH
AIPTIKQVLGRFGRALDPEFGSLILTTMFGKYDSSNSDIASIEKALATILDEVNLPFYEE
YNADVSEIMNQLFNRIRYIRIDDHGPKLGPVTDENPLIETYFTRLPLNDITKKHSPKALA
LVNNGWIWNADAMRDNAGPDSKAYLRREVIVWGDCVKLRYGSSPEDNPFLWDYMTKYTRL
MAKYFSGFRIDNCHSTPLAVAEYLLDEARKVRPNLTVFAELFTGSEEADYIFVKRLGINA
LIREAMQAWSTGELSRLVHRHGGRPIGSFDVELPSAGSSHAIASAGVNQNREKISHIRPC
PVQALFMDCTHDNETPAQKRDARDTLPNAALVSMCASAIGSVMGYDEIYPKLVDLVHEKR
LYFSEFSKSAEVHHDCESGGIGSVKKLLNELHTMMGVEGYDETHIHHDGEYITVHRVHPK
TRRGIFLIAHTAFPGHSTNAVLAPTHLVGTQAKHIGTWNLEVDASDSMRAEILSDKDHLR
GLPSRIRKFEGTKAEQQGDDTIISVLDTFAPGSIALFETSIAKAEHAAGLENHISEGADE
AFAELSLVDLNFVLYRCDAEERDLSGGQDGVYNVPNHGPLVYAGLQGWWSVLEDIIRYNA
LGHPLCDHLRHGQWALDFIVGRMEKAAKKEGYTALEKPAKWLQEKFQAVRDLPSFLLPRY
FGIIIQVAYNAAWKRGVQLLGPDVRQGQEFIHQLGMVSVQVTGIVKSASLWPTKTVPSLA
AGLPHFAVDWARCWGRDIFIALRGLFLCTARFDDAKEHILAFASVLKHGMIPNLLSSGKL
PRYNSRDSVWFFLQAIQDYTKMAPNGIEILNETVARRFVPYDDTWFAYDDPRAYSKHSTI
SQVIQEVLQRHAHGLSFREHNAGPDLDMQMKPEGFQIDVKVDWETGIIFGGSQHNCGTWQ
DKMGESGKAGNKGVPGTPRDGAAIEITGLLYSALTWVSRLHERGLYPHDKVDIAEGRSIT
FKEWAAKIKQNFERCYYVPESPEEDGQYDVDPSIVNRRGIYKDLYKSGKPYEDYQLRANF
PIAMTVSPDLFTPSKALGALALADSVIVGPIGVATLDPSDLNYNPNYNNSEDSDNFATAK
GRNYHQGPEWVWQRGFFLRAFLHFDLERRKTAEERTEAYQQVTRRLEGCKRALRESPWKG
LTELTNKNGAHCADSCPTQSWSAGCLLDLYYDASRHS
NT seq 4614 nt NT seq  +upstreamnt  +downstreamnt
atggcctctccgcagcaggtttacttgctccctttgaaagatgatggctctccagatgta
cctgggggatatatatatctcccaccgcccagtaatcctgcatatctattgcgtttcgtg
atagagggaagcagttcgatttgcagggagggaacactatgggtgaacattcccgagact
ggcaagccatttgatcgctcggtatttcggagcttcagattggagccagatttcaacaag
aatatccagatcgatattcctgttacctgtcctggatcctttttgttccacaccacattc
acgcccctacctcaattctctgtcggccctgttccgacccctgaaccagcgagaacacct
gattactacgtcgatgtcgcaccgaggttgacgcttcgtggtaaagatttgcctctcaat
gcgctctctatattctccgtgttgtctaaattcatgggcaaatatcccacggattgggac
agacacttgaatggtatcagccagcgcaactacaacatggtgcattttacaccgttgatg
aagcgcggagcttcaaattctccatatagtatctttgaccagttgcagttcgacgacggt
gcttttcccaacggtgaggtagatgttgcgcaaatgatctcgaaaatggagaaggaatat
ggacttctgtcattgaccgatgttgtgtggaatcacactgctcataatagcaagtggctc
gaggagcatccagaggctggttatagcgtggaaactgcaccatggcttgaggcggcttta
gaattggacaccgctctattgaagttcggtcaggaccttgagaaactaggtttgcccact
gaatttaagaccgtggatgacttgctggctgtcatgaccgcactacgagagaaggtaatc
agtggcatccgtctctgggagtactatgtcattgatgtcaaagccaacgctgggcatatc
ctagaaaactggaaagcttctgggttgaaacactccgcgtccaagaaatatgctgaagtg
gatatcggcggattcaaagattggcctttgaagcagcaggcagatctcgtacgtcaacat
gccattcccacgatcaagcaggttttgggacggttcggcagagcgcttgaccctgaattc
gggtctctgatcctgactactatgttcgggaagtatgactcttcaaactccgatattgcc
tcgattgagaaggcgctggcaactatactggatgaggtcaatctgccattctacgaggag
tacaatgcagacgtctctgaaattatgaatcaactgtttaaccgaatcaggtacatcagg
attgacgaccatggtccgaaacttgggcctgtcacggacgaaaatcctctgattgaaact
tacttcaccaggttacctcttaatgatatcacaaagaagcatagccccaaagcactagcc
cttgtgaacaacggctggatctggaatgcggatgctatgcgggataatgctggtcctgat
tcaaaagcctatttgcgtcgtgaagtcattgtttggggcgactgtgtcaagctcagatat
ggctcatctcctgaggacaatcctttcctttgggactatatgactaagtacacccgcctt
atggccaaatacttctccggcttccggatcgataattgccactcaacgccactggcagtt
gcagaatatctgttggatgaggcgcgtaaagtccgaccaaatcttacagtctttgccgag
ctctttacggggtccgaagaagcggactacatctttgttaagcggcttggtataaatgct
ctgattcgcgaggctatgcaagcctggagtaccggcgagctaagtcggttggtccatcgt
catggcggccgtcccataggcagtttcgatgttgagctgccgtcagcgggaagcagtcat
gcgattgcctccgccggggtcaaccagaatcgagaaaagatctctcatattcgtccctgt
cctgttcaagcacttttcatggattgtacacatgataacgaaacaccagcacagaaacgt
gatgcaagagacacattacccaatgctgctctggtttcgatgtgcgcctctgccatcgga
agcgtcatgggctatgacgagatatatcccaaacttgtggaccttgttcacgaaaagcgg
ctatacttttcggagttctcgaaatcagccgaggttcatcatgactgtgaaagcggcgga
attgggagtgtcaagaagctgttgaatgaacttcacacgatgatgggagtggagggatac
gatgaaacgcatatccaccatgacggagaatacatcaccgttcacagagtgcatcctaaa
acgcgcagagggattttcctgatcgctcacactgctttcccggggcatagtactaatgcg
gttcttgcgcccactcatctcgttggaacgcaggccaagcacatcggaacttggaacttg
gaagtagacgcgagcgatagcatgagagcagaaatcctatcggataaggatcacctgcga
ggactgcccagtcggattcggaaattcgaaggcacaaaggccgaacagcaaggcgatgat
accattatttcagttctcgatacgttcgctccgggatctatcgcactctttgagacgtcc
atcgccaaggctgaacatgcagcaggtttggagaaccacatctctgagggagcggacgaa
gcttttgcagagcttagtctggtcgatctcaatttcgtcctttaccgctgtgacgcggaa
gaaagggatttgagcggaggccaggacggggtctacaacgtccccaaccatgggccgttg
gtctacgccggtcttcagggatggtggagcgtcttggaagatatcatcaggtacaacgca
ctaggccatccactttgcgaccatctccgtcacggccagtgggctctagatttcatcgtc
gggcgcatggagaaagccgcaaagaaggaaggatacactgcactggagaagcctgctaaa
tggttgcaagagaagtttcaggcggtccgtgatttaccaagctttctgttaccgaggtac
ttcggtatcattatccaggtagcatacaatgctgcatggaagcgtggcgttcagctgctg
ggacccgatgtacggcagggacaggaattcatccatcaactgggcatggtcagtgtgcag
gtaactggcattgtgaaatccgcatctctttggcctacaaagaccgttcccagtcttgca
gctggtcttccgcattttgcagtggattgggcgagatgctggggccgtgacatcttcata
gcccttcgaggcctctttctttgcaccgcccgttttgatgacgccaaggagcatatccta
gcatttgccagtgtactcaaacacggcatgatcccgaacctcctaagtagtggcaagtta
ccccggtacaattctcgggattccgtgtggttcttcctccaggccattcaggactacaca
aaaatggcgcccaacggcattgaaatcttgaacgagacggttgccagacgctttgtgcct
tacgacgatacctggtttgcatatgatgaccctagggcatattcaaagcattcgactatt
tcgcaggtcattcaagaagtgctccagcgacacgcgcatggattgtcattccgagagcac
aacgccgggcctgatctcgacatgcaaatgaagccggaaggcttccagatcgatgtcaaa
gtcgactgggagacgggaataattttcggtggtagtcaacacaactgcggtacgtggcaa
gacaagatgggagaaagcggaaaggcgggaaacaagggcgttcctggtacacctcgcgat
ggtgccgcaatcgagatcaccgggctgctttatagcgcattgacttgggtttcccgcttg
catgagcgcggactctacccacacgacaaggttgacattgcggaagggaggtcgatcact
ttcaaggaatgggcggcgaagatcaagcagaactttgaacgctgctattatgtcccagaa
agccccgaggaagatggtcagtatgatgttgaccccagcattgtcaatcgccggggtatc
tacaaagatctttacaaatccggcaagccgtatgaggactatcagctccgcgccaatttc
cccattgccatgactgtgtctccagaccttttcacaccgtcgaaagcgttgggagctctg
gctctcgcagactctgtcattgtcggccccatcggtgtcgctactctggatccatccgat
ctcaactataaccccaattacaacaactcggaagactcggacaatttcgcgactgccaag
ggtaggaactaccaccagggacccgaatgggtctggcagcggggattctttcttcgtgct
ttcctgcactttgaccttgagcgccggaagacagcagaggaacggacggaggcgtatcaa
caagtgactcgacgcctagagggttgcaagcgcgcgctgagggagagtccatggaagggc
ctcacagagcttacaaacaagaacggagctcactgtgcagactcttgtcccactcagtca
tggtcggcaggttgcttacttgacctatattatgacgcctccagacattcttga

DBGET integrated database retrieval system