KEGG   Neosartorya fischeri: NFIA_022620Help
Entry
NFIA_022620       CDS       T01070                                 

Definition
eukaryotic translation initiation factor 3 subunit EifCb, putative
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
nfi  Neosartorya fischeri
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    NFIA_022620
Messenger RNA biogenesis [BR:nfi03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     NFIA_022620
Translation factors [BR:nfi03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    NFIA_022620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 740 aa AA seqDB search
MAPSFDTLSEQDLHEEEEEEIDFSDLKAQYEVKLEEGLDTFVVIDGLPVVPEESRQKLIK
FLLRKLNTVGHTSEDAVFMPLNDKNMSEGYAFVEFETPEQAVAAVKQLHGTPLDKKHTLL
VNKLMDIERYGREGRIDEEYKPPAIEPFKEKEHLRSWLADPNARDQFALHRGDKVGVFWN
NKNNPPENVVDRAHWTQLFAQWSPKGTYLASVHPQGVQLWGGPAFSKQKQFPHPFVQLIE
FSPGESYLTTWSARPIQVEEGQSILTYEEEGKNIIVWDIATGKPLRSFVSHDLTAGPAGD
AEPKKKVQWPAFKWSADEKYVARMLQHQSISIYELPRMNLLGKTSVKIDGVMDFEWSPAT
VTREGVKQYEQLLCFWTPEIGSSPARVAMMSVPSKEIVRTRNLFNVSDVKLHWQSQGSYV
CVKVDRHSKSKKSMATNLEIFRVREKGVPVEVVDSLKDTVINFAWEPNGNRFVLITTGEA
VAGAAVAPKTAVSFFAPEKKGGAIGNFKLIRTIEKKNSNAIYWSPKGRFVVVATVHSQTS
FDMDFWDMDFEGEKPEAEKDFAANLQLMKTIEHYGVTDIDWDPTGRYVVSSASVWTHQLE
NGWNMHTFAGQTLSENPTDKFKQFLWRPRPPTLLSKEEQKQVRKNLREYSKEFDEEDRYA
VDIANTAVVEKRKRVLNEWVAWIRREKELLAEEKDAYGLPEEADDPKLAKDAAATTQEQG
ETVVEEIVEEIIEESEEVIG
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccagtttcgatactttgtctgagcaggacctccacgaagaggaggaggaggag
attgacttctccgatctcaaggcgcaatatgaagtgaagctcgaagagggtttggataca
ttcgttgtgatcgatggactcccggttgtgcccgaggaaagcagacaaaagctcatcaag
ttcttgttgaggaaactcaacacggtgggccacacgtctgaagatgcggtctttatgccc
ctcaacgacaagaacatgtccgaaggatatgccttcgtcgagttcgagacccccgaacaa
gccgtcgccgcggtcaagcagctgcacggcactccccttgacaaaaagcacacccttctc
gtgaacaaattaatggatatcgaacgctacggtcgcgaagggcgcatcgacgaagagtac
aagccccccgccatcgagcctttcaaggagaaggagcatctccgctcgtggcttgcggac
cccaacgcgcgtgatcagtttgcccttcaccgtggagacaaggtgggcgttttctggaac
aacaagaacaatccgcccgagaatgtcgtcgaccgtgcgcactggacgcagcttttcgcc
cagtggtctcccaagggtacttacctcgcatccgttcaccctcagggtgttcagctctgg
ggtggtcccgctttctcgaaacagaagcaattcccccatcctttcgtccagctcatcgag
ttctcgcccggtgagagctatctgacgacctggtccgcgcgccccattcaggttgaggag
ggccagtctattttgacttacgaggaggaaggaaagaacattatcgtgtgggatattgcg
actggaaagcctctgcgttccttcgtctctcacgatctcactgctggtcctgcgggagac
gccgagcccaagaagaaggtgcagtggcctgcatttaagtggtctgccgatgaaaagtac
gtcgctcgcatgctacagcaccagtccatttcgatctacgagcttccacgaatgaacttg
ctcggaaagacatcggtgaagatcgacggcgtcatggactttgagtggtcacccgcaact
gtgactcgggagggcgtcaaacaatacgaacagttgctctgcttctggactcctgaaatc
ggcagcagccccgccagagttgccatgatgagcgtgccatcaaaagaaattgtacgaaca
cgtaatttgttcaatgtttccgacgtcaagcttcactggcagtcccagggttcgtatgtc
tgcgtgaaggtggatcgacactcgaaatcgaagaagtccatggccaccaacctcgagatt
ttccgggtacgcgagaagggtgtccctgttgaggttgttgacagtctcaaggatactgtg
atcaatttcgcttgggagcccaatggcaatcgattcgttctcatcacaaccggcgaggct
gtcgctggtgctgctgttgcacccaagaccgccgtgtcgttctttgcccctgagaagaag
ggcggagcaatcggtaacttcaagctcatccgcaccattgagaagaagaacagcaacgcg
atctactggtcgcctaagggtcgtttcgttgtcgttgctaccgttcactcccagaccagc
tttgacatggacttctgggacatggacttcgagggagagaagcccgaagccgagaaggac
tttgccgccaaccttcaattgatgaagactattgaacactacggtgtgacggatatcgac
tgggatcctaccggtcgttacgtcgtcagcagtgctagcgtgtggacacaccagttggaa
aacggctggaacatgcacactttcgccggtcagaccctctccgaaaaccccacagacaag
ttcaagcaattcctctggcgccctcgcccacccactcttctcagcaaggaggagcagaaa
caagtgcgcaagaaccttcgggaatactccaaggagttcgacgaggaggacagatacgcc
gtcgatattgccaacacagccgttgtcgagaagcgcaagcgggttctcaacgagtgggtt
gcctggattcgccgggagaaggagctccttgccgaagagaaggacgcctacggtctcccc
gaggaggccgacgaccccaagttggccaaggacgccgctgcaaccacacaagagcaaggg
gaaactgttgtggaggagattgtcgaagagatcatcgaggaaagcgaggaagttatcggt
taa

DBGET integrated database retrieval system