KEGG   Neosartorya fischeri: NFIA_026560Help
Entry
NFIA_026560       CDS       T01070                                 

Definition
stearoyl-CoA desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
nfi  Neosartorya fischeri
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    NFIA_026560
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    NFIA_026560
Enzymes [BR:nfi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     NFIA_026560
Lipid biosynthesis proteins [BR:nfi01004]
 Desaturase
  First
   NFIA_026560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 460 aa AA seqDB search
MISDDVQGPEAKPDDGTTDHAPMPKSKSTTARASHITEQPVTWSNWHQHINWLNCFFILF
VPLLGCIGAYWTPLHPRTALFALVYYFNAGLGITAGYHRCWAHCSYKATLPLKLYLAAVG
VAAGQGSIRWWARGHRAHHRYTDTEKDPYSVRKGLLYSHIGWLVMKQNYKKIGRTDVTDL
DADPVVVWQHKHYIKSALFMSLILPTLLCGLGWGDWQGGLIYAGILRVFFIQQATFCVNS
LAHWLGEQPFDDRNSPRDHVITALVTLGEGYHNFHHEFPSDYRNAIQWWQYDPTKWMIWI
WKQLGLAYDLKQFRYNEIEKGRLQQLQKKVDQKRATLDWGISLEQLPVIDWDEFATKSRS
TNKALVAIGGVIHDVSDFIKEHPGGKSFISSAIGKDATAMFNGGVYQHSNAAHNLLSTMR
VGILRGGCEVEQWKCVTSEGKRPLGIDSEQPQVDHAGNPR
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgatctctgatgacgtccagggccctgaggccaagcccgatgatggcaccactgaccac
gctcccatgccgaagagtaagagtaccaccgccagggcatcgcatatcactgagcagcct
gtgacatggtcaaactggcatcaacatatcaattggttgaactgcttcttcattcttttc
gtccctcttcttggttgtattggggcctactggacccctctacatccacgcacagccctc
tttgcgctcgtatactactttaatgcaggcctgggcattactgctgggtatcaccgatgc
tgggcgcattgttcgtataaagccaccctccccttaaagctttacttggccgccgtcggc
gtcgctgctggccagggctcgatacgctggtgggcgcgtggccaccgtgctcaccatcgc
tacacggatacagagaaggacccatactcagtccggaaagggctgttatattcgcacatc
ggatggctcgttatgaagcaaaactacaagaaaattggccgcaccgatgtcacagatctc
gacgcggatcctgtggtggtctggcagcataagcactatatcaaatccgccctgttcatg
agcttaatccttccgactctgttgtgtggcttgggatggggtgattggcagggtgggtta
atatatgctgggattctgcgcgttttctttatccaacaagccaccttctgtgtcaattca
ctggctcattggctgggtgagcagccgttcgatgaccgtaattccccgcgggatcatgtc
atcacagccctggtgacattaggtgaagggtatcataattttcaccatgaatttccttcc
gactaccgcaatgcaattcaatggtggcagtacgacccgaccaagtggatgatctggatc
tggaaacagcttgggctcgcctacgatctcaagcaatttcgctacaatgagattgaaaaa
ggacgactgcagcagctgcagaagaaggtggaccagaaacgcgcgacattagactggggc
atctccctcgaacaactccctgtgatagattgggacgagtttgctactaagtcgaggtcg
actaacaaggcccttgtggccattggtggcgtcattcatgatgtctccgacttcatcaag
gagcatccaggaggcaagtcattcatctcatcggccatcggaaaggacgccactgctatg
tttaacggaggggtctatcagcactccaatgccgcccataatctgctatcaacgatgcgc
gttggaatcctccgcggcggatgtgaagtggagcagtggaagtgcgtcacatctgagggt
aaacgacccctgggaattgactcggagcagccgcaggttgatcatgctggaaaccccagg
tga

DBGET integrated database retrieval system