KEGG   Neosartorya fischeri: NFIA_026950Help
Entry
NFIA_026950       CDS       T01070                                 

Definition
dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nfi  Neosartorya fischeri
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NFIA_026950
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NFIA_026950
   00020 Citrate cycle (TCA cycle)
    NFIA_026950
   00620 Pyruvate metabolism
    NFIA_026950
Enzymes [BR:nfi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NFIA_026950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 484 aa AA seqDB search
MVASAVRMRIPSAMLSKGGLCVRRPQVIHRFKDAVQPQLPALSALSRFYASKSFPPHTII
SMPALSPTMSAGNIGAWQKKAGDSLSPGDVLVEIETDKAQMDFEFQEEGVLAKVLKETGE
KDVSVGTPIAVLVEEGTDVAPFESFTLEDAGGDKGAAPAKESKEEPKAEAAPAPSTPEPA
PAAQEPETSTEKLQPSLDREPNISPAAKALALEKGVPIKALKGTGRGGQITKEDVEKYKP
SVSAATAPTYEDIPLTSMRKTIATRLQQSMRENPHFFVSTTLSVTKLLKLRQALNASAEG
KYKLSVNDFLVKACAAALLKVPAVNSSWREENGQVVIRQHNTVDISVAVATPNGLITPVV
KNVHGLGLSSISNQIKDLGKRARENKLKPEEYQGGTFTISNMGMNPAIERFTAVINPPQA
GILAVGTTRKVAVPVETEEGTSVEWDDQIIVTGSFDHKVVDGAVGAEWIKELKKIVENPL
ELLL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggttgcctcagctgtccgaatgcgcattcccagcgccatgttgtcgaaaggcggcctc
tgcgtgaggcggcctcaggttattcacagattcaaggacgctgtccaaccccaattgcct
gcgttatccgccctctcccgtttctatgcctccaagtcctttccccctcacaccatcatc
agcatgcctgccctctcgcccacaatgtccgcaggaaacattggagcttggcagaagaag
gccggtgattccctgtcgccgggtgatgttctcgtggaaatcgagaccgataaggcacag
atggactttgaattccaagaggagggtgtcttggccaaggttctgaaggagactggtgag
aaggatgtgtctgtcggcactcctatcgccgtccttgtggaggaaggaacagatgtcgcc
ccctttgagagctttactctggaagacgccggtggtgataagggagctgctcccgccaag
gagagcaaggaggagcccaaggctgaggctgcaccagccccctcgacgcccgagcctgca
cccgccgctcaggagcctgagacatctactgagaagctccagcctagtcttgaccgtgag
cccaacatcagccctgctgccaaggcattggccctggagaaaggtgttccgatcaaggct
ctcaagggtactgggcgtggtggtcagatcaccaaggaagatgtggagaagtacaagcct
agcgtttccgccgccaccgcccctacatatgaagacatccctctcacatctatgcgcaag
accattgctacccgcctgcagcagtcgatgagagagaaccctcacttcttcgtttcgacc
actctgtccgttacgaagcttctgaagctacgccaggctctcaacgcttctgctgagggc
aaatacaagctctccgtcaacgacttccttgtcaaggcttgtgccgccgctcttctgaag
gtccctgcggtcaactcgagctggcgcgaggagaacggccaggttgtcatccgccagcac
aacaccgttgatattagtgttgctgttgccactcctaatggtcttattactcccgttgtc
aagaacgtacatggtcttggcctttccagcatctctaaccagatcaaggacctcggtaag
cgcgctcgggagaacaagctcaagcctgaggagtaccagggcggcacttttaccatcagc
aacatgggcatgaaccctgctattgagcgattcaccgctgtcatcaacccccctcaggct
ggtattttggccgtcggcaccacccgcaaggttgctgttcccgttgagactgaggagggt
acctctgttgagtgggatgaccagattatcgtgactggcagcttcgaccacaaggttgtc
gatggtgctgttggtgctgaatggatcaaggaactgaagaagattgttgagaaccccctg
gagcttcttctgtga

DBGET integrated database retrieval system