KEGG   Neosartorya fischeri: NFIA_027160Help
Entry
NFIA_027160       CDS       T01070                                 

Definition
stearoyl-CoA desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
nfi  Neosartorya fischeri
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:nfi01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:nfi01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 456 aa AA seqDB search
MSAKPADASRPRAGDPKKVHIADTAITRQNWYKHVNWLNVFLIIGIPLYGCIQAFWVPLQ
LKTAIWAVVYYFFTGLGITAGYHRLWAHCSYSARLPLRIWLAAVGGGAVEGSIRWWARDH
RAHHRYTDTDKDPYSVRKGLLYSHLGWMVMKQNPKRIGRTDITDLNEDPVVVWQHRNYLK
VVLMMGLVVPMLVAGLGWGDWFGGFIYAGILRIFFVQQATFCVNSLAHWLGDQPFDDRNS
PRDHVITALVTLGEGYHNFHHEFPSDYRNAIEWHQYDPTKWTIWIWKQLGLAYDLKQFRA
NEIEKGRIQQLQKKIDQKRAKLDWGIPLDQLPVMEWDDYVEQAKNGRGLIAIAGVVHDVT
DFIKDHPGGKAMINSGIGKDATAMFNGGVYYHSNAAHNLLSTMRVGVIRGGCEVEIWKRA
QKESSEYVRDESGQRIIRAGQQVTKIPEPIPTADAA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgaagcctgcagatgcttctcgccctcgggctggtgaccccaagaaggtccat
atcgccgacacggccatcactcgtcagaactggtacaagcatgtcaactggctgaacgtc
ttcctcatcatcggtatccccttgtacgggtgcatccaggctttctgggtgcctctgcag
ctcaagaccgccatctgggccgttgtctactacttcttcaccggtctcggtatcacagca
ggataccatcgtctttgggctcactgctcctactctgctcgtctgcctctgcgtatctgg
ctcgcagccgttggcggtggtgcagtggaagggtccatccgctggtgggctcgtgaccac
cgcgctcaccaccgttataccgacactgacaaggatccctactctgttcgcaagggtctc
ctttactcgcacctcggctggatggttatgaagcagaatcccaagcgtatcggccgtacc
gacatcaccgatttgaacgaagatcccgtcgtcgtgtggcaacaccgcaactacctgaag
gtcgtcctgatgatggggctcgtcgtgcccatgctcgtggccggtctcggctggggtgac
tggtttggcggcttcatctatgccggtattctgcgtatcttcttcgttcagcaagccact
ttctgcgtcaactctctggcccactggctcggcgaccagcccttcgacgaccgcaactcc
cccagagatcacgttatcactgctctggtcactcttggcgagggttaccataacttccac
cacgaattcccctcggattaccgcaacgccattgagtggcaccagtatgatcccaccaag
tggaccatctggatctggaagcagcttggtctagcctatgatctgaagcagttccgtgcc
aatgaaattgaaaagggtcgtattcagcagctccagaagaagatcgaccagaagcgtgcc
aagttggattggggtatcccactcgatcagcttcccgtcatggagtgggatgactatgtt
gaacaggccaagaacggccgcggactgattgctattgctggtgttgtccacgatgtgacc
gatttcatcaaggaccaccctggtggcaaggctatgatcaactccggcattggcaaggat
gctactgccatgttcaatggtggtgtttactaccactcaaatgctgctcacaacctgctg
tctaccatgcgtgtcggcgttatccgcggcggctgtgaagttgagatctggaagcgtgct
cagaaggagagcagcgaatatgtccgcgatgagtccggtcagcgcattatccgcgctggt
cagcaggtcaccaagatccccgagcccattcccaccgctgacgcggcatga

DBGET integrated database retrieval system