KEGG   Aspergillus fischeri: NFIA_027990Help
Entry
NFIA_027990       CDS       T01070                                 

Definition
(RefSeq) tannase and feruloyl esterase family protein
Organism
nfi  Aspergillus fischeri
SSDB OrthologParalogGFIT
Motif
Pfam: Tannase
Motif
Other DBs
NCBI-GeneID: 4587972
NCBI-ProteinID: XP_001261622
UniProt: A1DD15
AA seq 573 aa AA seqDB search
MRPSTWIPFTVGLAVVTHAATPSTLEELCTVSYLQNVLPPSKFIQGITIDSDSLTTSVVT
KSTVSSFDYPTAMIDYCNVTLAYSHDGIDGDRVLLQIWLPAPTNFQNRWLSTGGGGYAIN
SGARMLPEGIIYGAASGLTDGGFGGFSVNADSAMLLANGTLNYEALYMFGYKAHRELSLI
GKAITRNVYGMADSEKLYAYYHGCSEGGREGWSQVQRYGDEWDGAIIGAPAFRWSFQQTQ
HLFSNIVEKTLDYYPPPCELERIVNETIVACDPLDGRTDGVVARTDLCLLRFDPKVIVGK
KYSCTASATAPAQSGTVSAKAVEVAKTIINGLHDTQGRRVYFSYQPSAAFDDAQTQYNTT
TGKWELSINQLGGEHIALLVNKNGTTLDSLDGITYDTLKDWMISGMQEYYSTLQTTWPDL
TPFHHAGGKVIHYHGDADFSIPTASSIRYWESVRSTMYGNLSYKAGANALNEWYRLYTVP
GAGHCSTNDAMPNGPWPQTNLATMIEWVEKGVTPVTLNATVLQGEYEGENQQLCAWPLRP
LWKNNGKTLDCVYDQASIDSWHYDLDAVPMPVY
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgcgtccctctacctggattcccttcaccgtgggcctggccgttgtgacccatgcagcg
actccgtcaacactggaggagctctgcactgtttcttatcttcaaaatgtgttgcctcca
tccaagttcatccagggcatcacaattgactcagactctctcacgaccagcgtggtgacc
aagagcactgtcagcagctttgactaccctacggcgatgatcgactattgcaatgtcacc
ctggcctactcgcacgatggcatcgacggcgaccgagtcctactccaaatatggctacca
gctcctaccaacttccaaaaccgatggttgtctaccggagggggtggttatgccatcaat
tccggagcgcgcatgctccctgagggtatcatctacggtgcggcgtctggactcacggac
ggtgggtttgggggcttctcggtcaatgccgacagcgctatgttgctggccaacggcaca
ctgaactatgaggcgctgtacatgttcgggtacaaggctcaccgggaacttagcttgatt
ggcaaggccatcacgcggaatgtctacggcatggccgatagtgagaagctctacgcctac
taccatggatgctccgagggtggccgtgagggctggagccaagtgcagcgctatggagat
gaatgggatggggccattattggggctccagcgtttcgttggtcgttccagcagacccag
cacctcttctcgaatattgttgaaaagactctcgactactatcccccgccctgcgagctg
gagaggattgtgaatgagactatcgtcgcatgtgatcccctggatggcaggactgacggt
gtagtggctagaaccgatctttgcttgctgcgttttgatccgaaagttatcgtgggcaag
aagtactcctgcaccgcgtctgccaccgcgccggcccagagtggcactgtttcagccaag
gcagtcgaggtcgccaaaaccatcattaacggactgcatgatacccagggccgtcgtgtg
tacttctcctaccagcccagcgccgcatttgacgatgctcagacgcagtacaacaccacc
actggcaagtgggagctgtctatcaaccaactcgggggcgaacacattgcactgctggtg
aacaagaacggcacaactctggacagtctggacgggatcacctacgacacgttgaaagac
tggatgatttcgggcatgcaggagtactacagcaccctgcaaactacctggcctgatcta
acaccattccaccacgctggcggcaaagtgatacactaccatggcgacgctgacttcagc
attcccactgcttcgtcgatccgctactgggagtcggtccggagtaccatgtacggcaac
ctgtcgtacaaagctggtgctaacgctctgaatgaatggtaccgcttgtacactgtgcca
ggtgccggccactgctcgaccaacgatgccatgcccaatggtccgtggcctcagaccaac
ctcgctaccatgattgaatgggtcgaaaagggagtgacaccggtcaccctgaatgcaaca
gtgctccagggggagtatgaaggcgagaaccagcagctctgcgcgtggccattgcgccct
ctctggaagaacaacggaaagaccctagactgtgtctatgaccaggcgtccatcgacagc
tggcactatgatttggatgcagttcctatgcctgtatattag

DBGET integrated database retrieval system