KEGG   Neosartorya fischeri: NFIA_027990Help
Entry
NFIA_027990       CDS       T01070                                 

Definition
tannase and feruloyl esterase family protein
Orthology
K10759  
tannase [EC:3.1.1.20]
Organism
nfi  Neosartorya fischeri
Brite
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.20  tannase
     NFIA_027990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 573 aa AA seqDB search
MRPSTWIPFTVGLAVVTHAATPSTLEELCTVSYLQNVLPPSKFIQGITIDSDSLTTSVVT
KSTVSSFDYPTAMIDYCNVTLAYSHDGIDGDRVLLQIWLPAPTNFQNRWLSTGGGGYAIN
SGARMLPEGIIYGAASGLTDGGFGGFSVNADSAMLLANGTLNYEALYMFGYKAHRELSLI
GKAITRNVYGMADSEKLYAYYHGCSEGGREGWSQVQRYGDEWDGAIIGAPAFRWSFQQTQ
HLFSNIVEKTLDYYPPPCELERIVNETIVACDPLDGRTDGVVARTDLCLLRFDPKVIVGK
KYSCTASATAPAQSGTVSAKAVEVAKTIINGLHDTQGRRVYFSYQPSAAFDDAQTQYNTT
TGKWELSINQLGGEHIALLVNKNGTTLDSLDGITYDTLKDWMISGMQEYYSTLQTTWPDL
TPFHHAGGKVIHYHGDADFSIPTASSIRYWESVRSTMYGNLSYKAGANALNEWYRLYTVP
GAGHCSTNDAMPNGPWPQTNLATMIEWVEKGVTPVTLNATVLQGEYEGENQQLCAWPLRP
LWKNNGKTLDCVYDQASIDSWHYDLDAVPMPVY
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgcgtccctctacctggattcccttcaccgtgggcctggccgttgtgacccatgcagcg
actccgtcaacactggaggagctctgcactgtttcttatcttcaaaatgtgttgcctcca
tccaagttcatccagggcatcacaattgactcagactctctcacgaccagcgtggtgacc
aagagcactgtcagcagctttgactaccctacggcgatgatcgactattgcaatgtcacc
ctggcctactcgcacgatggcatcgacggcgaccgagtcctactccaaatatggctacca
gctcctaccaacttccaaaaccgatggttgtctaccggagggggtggttatgccatcaat
tccggagcgcgcatgctccctgagggtatcatctacggtgcggcgtctggactcacggac
ggtgggtttgggggcttctcggtcaatgccgacagcgctatgttgctggccaacggcaca
ctgaactatgaggcgctgtacatgttcgggtacaaggctcaccgggaacttagcttgatt
ggcaaggccatcacgcggaatgtctacggcatggccgatagtgagaagctctacgcctac
taccatggatgctccgagggtggccgtgagggctggagccaagtgcagcgctatggagat
gaatgggatggggccattattggggctccagcgtttcgttggtcgttccagcagacccag
cacctcttctcgaatattgttgaaaagactctcgactactatcccccgccctgcgagctg
gagaggattgtgaatgagactatcgtcgcatgtgatcccctggatggcaggactgacggt
gtagtggctagaaccgatctttgcttgctgcgttttgatccgaaagttatcgtgggcaag
aagtactcctgcaccgcgtctgccaccgcgccggcccagagtggcactgtttcagccaag
gcagtcgaggtcgccaaaaccatcattaacggactgcatgatacccagggccgtcgtgtg
tacttctcctaccagcccagcgccgcatttgacgatgctcagacgcagtacaacaccacc
actggcaagtgggagctgtctatcaaccaactcgggggcgaacacattgcactgctggtg
aacaagaacggcacaactctggacagtctggacgggatcacctacgacacgttgaaagac
tggatgatttcgggcatgcaggagtactacagcaccctgcaaactacctggcctgatcta
acaccattccaccacgctggcggcaaagtgatacactaccatggcgacgctgacttcagc
attcccactgcttcgtcgatccgctactgggagtcggtccggagtaccatgtacggcaac
ctgtcgtacaaagctggtgctaacgctctgaatgaatggtaccgcttgtacactgtgcca
ggtgccggccactgctcgaccaacgatgccatgcccaatggtccgtggcctcagaccaac
ctcgctaccatgattgaatgggtcgaaaagggagtgacaccggtcaccctgaatgcaaca
gtgctccagggggagtatgaaggcgagaaccagcagctctgcgcgtggccattgcgccct
ctctggaagaacaacggaaagaccctagactgtgtctatgaccaggcgtccatcgacagc
tggcactatgatttggatgcagttcctatgcctgtatattag

DBGET integrated database retrieval system