KEGG   Neosartorya fischeri: NFIA_029000Help
Entry
NFIA_029000       CDS       T01070                                 

Definition
TFIIH and nucleotide excision repair factor 3 complexes subunit (Tfb2), putative
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
nfi  Neosartorya fischeri
Pathway
Basal transcription factors
Nucleotide excision repair
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:nfi03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:nfi03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 468 aa AA seqDB search
MAAAPPRPFDYLESLPGTVFNKLYQQPSTALAIFRRMLPDLAKCFVMALLYLKDPLPAAD
LEAWVRPDSLKLHIMTSTTTSDNVKAYTVTDPFASSLRQALTGAEQTQSFGVLSQISDEE
AVSIADLDEYARRQWEGVLGYMVGTSGLGMQRDVSLSKGVKELLQAGHLVEIRDRRVEIT
QDGFAFVLQDVGTQVWHILVLYVESAAAIGMDSVEVLSFVFFLSSLELGKSYEKKQLTSN
QLRTLTDLADFGIVYQETPDATHFYPTRLATTLTSDSSTLSNPLAGSLSGPTGTSSSKAG
SGFIIIETNYRLYAYTSSPLQISLIALFTTLKYRFPNLITGKITRQSVRRAVEMGITADQ
IISYLSTHAHPQMRKHNVSRSTSNQAGMPVSVLPPTVVDQIRLWQLERDRVKATHGFLFR
DFNTLAEYEAPCRYAEEIGVLVWKSDRKRMFFVTRHHQVAAFLKSRRK
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggctgcggcaccaccgcgtcctttcgattacctggagagcttgcctgggactgtcttc
aacaagctctaccagcagccctccactgctctcgccattttcaggcgcatgctgcctgac
ctggcaaaatgttttgtgatggcccttctctacctcaaggacccacttccagcagcggat
ttggaggcgtgggtcagaccagacagtttgaagttgcacattatgaccagcactacgacg
tcggataacgtaaaagcatacaccgtcaccgatccttttgcatcctctcttcggcaggct
ctcaccggcgccgagcaaactcaatcgttcggtgtcctgtcgcagatatctgacgaagaa
gccgtctccattgcggatctggacgagtatgccagacggcagtgggaaggagttctggga
tacatggtggggacaagtggactaggcatgcaacgcgacgtcagtttgagcaaaggcgtc
aaggaactcttgcaggcgggccaccttgtcgagatcagggatcgtcgagtggaaattact
caggacgggttcgctttcgttctacaggacgttggcactcaagtatggcatatcctagtt
ctttatgttgaaagcgccgcggccatcggtatggacagcgtcgaggtgctttcctttgtg
ttcttcctgagcagtttggaactggggaaatcgtatgagaagaagcagttgacgtccaac
caattgcgcactctgaccgacttggccgactttggtatcgtctaccaagaaaccccggat
gccactcatttctacccgacgcgcctcgcaaccaccttgacatccgactccagcactctg
agcaatcctctcgctggctccctttccggacctacgggcacatcctcgagcaaggccggt
tccggattcatcatcatcgaaacaaattaccgactctacgcatatacctcctcaccgctc
cagatctccctcattgcacttttcaccacattgaaatatcgcttcccgaatttgatcacg
ggtaaaatcacccgccagtccgtccgtcgtgcagtcgagatgggcattaccgccgatcaa
atcatctcttacctatcaacacacgcacacccgcaaatgcgcaagcacaatgtgtccagg
tctacttctaatcaagccggaatgccggtgtccgtcctaccgcctaccgtcgtggatcag
attcgtctttggcagctcgagagagatcgcgtcaaagcgacacatggctttttattcagg
gacttcaacactctggccgagtatgaggccccgtgtcgatatgccgaggagatcggcgtt
ctggtctggaaatctgatcgcaagcggatgttctttgtcactcgacatcaccaggttgct
gctttcttgaagagcaggaggaagtaa

DBGET integrated database retrieval system