KEGG   Neosartorya fischeri: NFIA_029190Help
Entry
NFIA_029190       CDS       T01070                                 

Definition
myo-inositol-1(or 4)-monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
nfi  Neosartorya fischeri
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:nfi00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 357 aa AA seqDB search
MDPSCPYSKELQLACLTVQRAALLTKRLLEAVDKGSLDKSDSTPVTIADFAAQALIIGAI
HKVFPEDEFVGEEDSKALRADPELLERTWELASTIHLDDKDSEALLYAPKSKEEMLDLID
LGARGKCSLESRAWVLDPVDGTATFMQGQQYAVCLALVENGCQKVGVLGCPNLNLATGRL
REDVVDRDGYGSQVFAVAGQGAWIRKMGRGGLLAAESIAQKPQITDPKDLDFVDCGSATS
SNTSLHARVASKLGAPWPYSTDLWAAQLRYIAIAVGGCNALIKIPRKASYRSKIWDHAGG
MLIAEEVGVKVTDLAGNPVDCSLGRTLAECYGMIVAPPSIHGRIVEAVKEVMQEQTK
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggatcccagttgtccttattccaaagaactacaacttgcatgcctcacggtgcaacgg
gctgcactattgacgaagagattgctcgaggctgtcgacaaaggatctctcgacaagagt
gattccacgcctgtgaccatcgccgactttgctgctcaagcacttatcattggcgctatc
cacaaagtctttcctgaagatgaatttgtgggtgaggaggactcaaaggctctccgtgca
gatccagaacttcttgagcgcacgtgggagctcgcctctaccattcatctcgatgacaag
gacagtgaagcccttctctacgctcccaaatccaaggaggaaatgcttgacttgattgat
cttggagctcgtggcaaatgtagcctggagagtcgtgcctgggttctggatcctgtcgat
ggcactgcgactttcatgcagggccagcagtatgcggtgtgcctggcactggtggagaat
ggatgccagaaggttggcgtgttgggttgcccgaatctcaatcttgctacgggccgtctt
cgagaggatgttgtggatcgagatggctacgggtctcaagtctttgcagttgctggtcaa
ggtgcctggatacggaagatgggacgcggaggtctgctcgctgctgagagtatcgctcag
aagccacagattacagacccgaaggacctcgatttcgtggactgtgggtccgccacatca
tctaatacctctttgcatgctcgagtggcatcgaaactgggtgctccgtggccgtacagc
actgatctctgggctgcacagttgcgctacatagccatcgcggtaggaggctgcaacgct
ttgatcaagatcccccgtaaggcatcttatcggtctaagatctgggatcatgcaggcggc
atgttgattgccgaggaagtcggcgttaaggtcaccgatcttgcaggaaatcctgtcgac
tgcagcttgggccgaaccctagctgaatgctacgggatgatcgtggctcctccctccatt
catgggcggatcgttgaagccgtaaaggaggtcatgcaggaacagaccaagtga

DBGET integrated database retrieval system