KEGG   Neosartorya fischeri: NFIA_029550Help
Entry
NFIA_029550       CDS       T01070                                 

Definition
protein kinase Yak1, putative
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
nfi  Neosartorya fischeri
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 894 aa AA seqDB search
MGSQWQPYQDPLMGRPAQFNNGLASTPQQLGPKYGGQPQQSQPPVGYTYEAFQTPGTAAK
PPSAGANSKSVSMASSPAATPRSRDYVTDADTTMEDADPYNRAKYSARPNHHSRPSSQFF
SPEESSAARRYSPMNVLSPSLSYNTSPGKSQNSYAFPPGPNNSRRSPTRALNYSSPAQPF
QSPPSVSRPPRLPPLQPTEMGSDQFYPPSAGSQVNAHFGQDGRSPRSGSMSGASKQAGRG
PVPKFQKIKSVQELQPRINAQPPYRRANPEGGFISPLQALTSHLPATYRICNPSFNYESS
RNPRRVLTKPSKGVKNDGYDNEDSDYILYVNDILGSEEAGHKNRYLILDVLGQGTFGQVV
KCQNLKTQEVVAVKVIKNKTAYFNQSMMEVSVLDLLNSKYDKNDDHHLLRLKDTFIHRQH
LCLVFELLSVNLYELIKQNQFRGLSTTLVRVFAQQLLNALSLLNKAHLIHCDLKPENILL
KNLESPIIKVIDFGSACDERQTVYTYIQSRFYRSPEVLLGLPYSSAIDMWSLGCIVVELF
LGLPLFPGSSEYNQVCRIVEMLGLPPTWMLEMGKQSGEFFEKTQDEFGRKTYRLKSLEQY
SREHNTKEQPSKKYFQASTLEEIIRSYPMPRKNMKQAEIERELNNRVAFIDFVRGLLSIN
PLERWSPQQAKLHPFITQQKFTGPFVPPMNLKYSSLNKTIPPGIQQQQQAEAASKQRAAQ
AAHAQSAAQNAYSMQMNQFHTPSHGQPPPMYNGMFTGHQQGAPPPYPAQPPGYGHQMNLM
PGQMPQSQYAPSQSLYAQATTRAGRQRASTMDHQGGGIPPTIQRVASHLDPNAPIRLQPS
PAYYPPPPDGYVDNNAQRRRGSRAGAGQRNRDFIRTLEDGVLGGDSYMNQSQWH
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atgggttctcagtggcagccgtaccaggaccccttgatgggacgtcctgcgcagttcaac
aatggattggcgtctaccccacaacaattaggccccaagtatggtggtcagccgcaacag
tctcagccgcccgtgggatatacctatgaagccttccaaacgcccggaacagcagcgaaa
cctccctcggccggcgcaaactccaaatcggtatctatggcgtcgtcgccagccgcaacg
ccacgtagccgcgattatgtcaccgatgccgatacgaccatggaggatgcggacccgtac
aacagggcgaagtactctgcgcgaccgaatcatcatagtcgaccatcgtctcaattcttc
tctcctgaggagtcctcggctgcccgaaggtactccccgatgaatgttctgtcgccgtcc
ttgtcttacaatactagtcctggaaagtctcagaactcatatgctttcccgcccgggcca
aacaactctcgccggtcgccgaccagagctctgaactactcctcgcccgctcagccattt
cagtcgcctccctctgtgtcacgtcctcctcggctccctccgctgcagcctaccgagatg
ggctccgaccaattctacccgccttcagcaggatctcaagtcaacgctcactttggacaa
gatggcagatcgccccggtcgggatccatgtcgggtgcgagcaagcaggccggtcgaggg
ccagtgccgaagtttcaaaagatcaagtcggtgcaggagctccaaccccgcattaatgcg
cagcctccatacagacgtgccaatccagaaggtggtttcattagtccccttcaagcgtta
acgtcccatcttccggccacataccgtatctgcaatccaagcttcaattacgagtcttcg
cggaatcccagacgtgtcctcacgaaaccaagcaagggagtcaaaaacgacggctatgac
aatgaggacagcgattatattctatatgtgaacgacattcttggaagcgaagaagcgggt
cacaagaatcgttacctcattctcgacgtgttgggccaggggacgtttggtcaagtcgtc
aagtgccagaatctgaaaacccaagaggttgttgccgtgaaagtcattaagaataagact
gcatacttcaatcagagtatgatggaagtctcggtcttggacttgcttaacagcaaatac
gacaagaacgacgaccaccacttgcttcgtctgaaggatactttcatccaccggcagcat
ctctgtctggtctttgaattgctcagtgtcaatctttatgaattgatcaagcaaaaccag
tttcgtggtttgagcacgactctcgtccgtgtttttgcccagcaacttctcaacgcattg
agtctgctaaacaaggcgcatctgattcattgtgatctcaagcccgagaacatattgctg
aagaatcttgagagtccaattatcaaagtcatcgatttcggctctgcttgcgatgagcga
caaactgtctatacgtatatccagtcgagattctaccgttcccccgaggtgttgcttggc
ttaccttactcgtctgcaatcgatatgtggtctcttggttgcatcgtcgtcgagcttttc
cttggtctgcctcttttccctggctcctccgaatataatcaggtctgtcgaattgtggaa
atgctcggtctacccccgacgtggatgcttgaaatgggcaagcagtcaggtgaattcttt
gagaagacccaagacgagttcggtcgcaagacataccgactgaaaagcctggaacaatac
tcccgggaacataacacgaaagagcaaccgagcaaaaagtatttccaggcttccacgctt
gaagaaatcatccgaagctatccaatgcctaggaagaatatgaagcaagccgagatcgag
cgagaattgaacaatcgagttgctttcatcgactttgttcgtggactgctgtcaatcaac
cctcttgagcgatggtcgccccaacaagccaagctgcaccctttcattacgcagcagaag
tttacagggcccttcgtgccgccaatgaatctgaaatattcctcgctcaacaaaaccatt
ccacctggaatacagcagcaacagcaggctgaggctgctagcaaacagcgagcggcccag
gcggcacatgcacagtcagcggcccagaatgcatactcaatgcagatgaaccagttccat
acaccctctcatggccaacccccgcccatgtacaacggcatgtttaccggccatcagcaa
ggcgcccctcctccatatcctgcccagccgccgggctacggccatcaaatgaaccttatg
ccaggccagatgcctcaatcgcaatatgcaccgtctcaaagtctctacgctcaagcaacc
actagagctggtcgccaacgcgcatccaccatggaccatcagggaggaggaattccgcca
actattcaacgcgttgccagccacctggacccgaatgcccccattcgactccagcccagc
ccagcgtattacccgccacctcctgacggatatgtcgacaacaatgctcaacggcgcagg
ggaagccgtgcaggggccggtcaacgtaaccgagacttcattcggactctcgaggacggt
gtccttggcggcgacagctatatgaaccagagccagtggcactga

DBGET integrated database retrieval system