KEGG   Neosartorya fischeri: NFIA_030460Help
Entry
NFIA_030460       CDS       T01070                                 

Definition
Patatin-like serine hydrolase, putative
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
nfi  Neosartorya fischeri
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NFIA_030460
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     NFIA_030460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1460 aa AA seqDB search
MAGWIGWVFSFFFQVIPSVLYWVITFSTITLPTWLFTLFSMSLTFTMNFTTLLLIVLAMV
STISWFIRYRFLNMYSRLPPEPQRKEPQVDLFPDVQEGDSKPGLANYLDEFLSAIKVFGY
LERPVFHELTRTMQTRKLIAGETLMLEEEKGFCLVVDGLVQIFVKSMRDGKSDTDEELHH
LGAESSDEEHHIDGKQGYQLLTEVKNGASMSSLFSILSLFTEDIQLRENESSGSSSSSIA
LRAARVPNSIPTSPRGVMDSPSLGFQDHSDDTSNMITNGDLPSVPPLHLGESHTPPSGDQ
HHQQHHESRKHSSRKRRKSVHPDIVARAMVDTTIAIIPASAFRRLTRVYPRATAHIVQVI
LTRLQRVTFATAHSYLGLSNEVLGIEKQMTKFTTYDLPNNMRGAALDRLKDKFIKERDRL
GSEEVTKGIALHNPSAGRRRRSSSFLRKDAALQVKMMTPRRAATVVTPESAPAEHDTYGV
SPGDLLSTIQSSRFGPRYEQPPAKLQSPLAEKENTHFRLPAMQARHTFRRQDTMDEDALF
RECILDCIMKGIGLTSSTRDALRKSSHSGDASPKLLSYDSRRQKAIFTNNAFGFIDPYEG
SGDGETESLMSMSVTSAGGTSPVINLREELRNDIEIVYFPKGSVLVEQGERHPGLYYVID
GFLDVGVPIVEKGEDLVGVSKPAASKESFPTLKRTTTANSIGAGGTAANDSRRRKQSRKS
LYLIKPGGIQGYVGAVASYRSYTDVVAKTDVYVGFLPRASLERIAERYPIALLTLAKRLT
SILPRLLLHIDFALEWLQVNAGQVIYHQGDESDAIYLVLNGRLRSVLESPGNKLAVIGEY
GQGESVGELEVMTESTRPATLHAIRDTELAKFPRSLFNSLAQEHPGITIQVSKLIAQRMR
DLVERPVTEKGVERSNAGGVQTATSTVNLRTVGILPVTAGVPVVEFGNRLLHALHQVGVT
NGVTSLNQAAILNHLGRHAFSKMGKLKLSQYLADLEEKYGMVLYIADTNVSSPWTQTCIT
QADCILLVGLAESSPSIGEYERFLLGMKTTARKELVLLHSERYCPPGLTRRWLKNRVWIN
GGHHHIQMAFRLTAEPSHPETKRFGTVLKQRVQVLQAEIQKYTSRRIRQTPLYSAQSPFK
GDFHRLARRLCGRAVGLVLGGGGARGIAHVGVIKALEEAGIPVDIIGGTSIGSFIGALYA
RDADVVPMYGRAKKFAGRMGSMWRFALDLTYPTVSYTTGHEFNRGIFKTFGDSQIEDFWL
EFYCNTTNISKSRPEYHSSGYVWRYVRASMSLAGLIPPICDEGSMLLDGGYIDNLTVDHM
KGLGADVIFAVDVGSIDDNTPQVYGDSLSGFWSVFNRWNPFSSCPNPPTLSEIQARLAYV
SSIDNLERAKNIPGCLYMRPPIDGYGTLEFGKFDEIYQVGYAFGKQFLEKLKTEGSLPLP
EETEEKKKLQRTMAPRRASI
NT seq 4383 nt NT seq  +upstreamnt  +downstreamnt
atggcggggtggatcggatgggttttttccttctttttccaggtcattccaagcgttcta
tactgggtcatcactttttctaccatcacattgcccacatggctgttcacactcttttcc
atgagcctgacgttcacaatgaacttcacgacgctcttgttaatcgttctggcgatggtt
tcgaccatcagctggtttatccggtaccgctttctgaacatgtacagtcgattacctccc
gagccccaacgtaaggaaccgcaggttgatctcttccccgatgtacaagaaggagattcg
aagccagggctggccaattacctggacgagttcctcagcgccatcaaagtttttgggtac
ttggaacggccagtcttccacgaattgacccggacaatgcaaaccaggaagctgatcgcg
ggcgaaacgcttatgttggaggaagaaaagggattctgtctagtagtcgacgggttggtc
cagatttttgtaaagtccatgcgagacggaaagtcggatacagatgaggagctgcaccat
ctcggagccgaatcctcggacgaggaacaccatatcgacggcaagcagggataccaattg
ctgaccgaggtcaagaatggcgcgtcgatgtcgtccttattctcaattctctcgctgttc
acagaggacattcaactacgggagaacgagagctcgggttccagttcctccagcatcgcc
cttcgcgctgctcgcgtacccaactcaatcccaacgagtcctcggggagtgatggatagc
ccttccttgggctttcaagaccacagcgacgatacctctaatatgatcaccaacggagat
ctgccatccgtgcccccgctgcatctgggggagagccacactcctccttccggtgaccag
caccatcagcagcaccatgaaagtcggaagcactctagcagaaaacgccggaagtcggtc
catcctgacattgttgcccgtgctatggtggacaccacaatcgcaatcatcccagccagc
gctttccggcgactgaccagggtctacccaagggcaaccgcccacatcgtccaggtcatc
ctcacccgcctacagagagttacgtttgcaacggcgcattcctatcttggcctcagcaac
gaggtgcttggaattgaaaagcaaatgaccaagtttaccacgtatgatctgccaaacaac
atgcgcggcgcagctctggatcgcctcaaagacaagttcatcaaggagcgggatcgccta
ggctctgaggaagtcacgaagggaattgccctacacaatccatctgcgggtagacgacgc
cgatcgagcagcttcctgagaaaggatgctgcgctgcaagtcaagatgatgacgcccaga
cgtgcggctaccgtggttaccccggagagtgcacccgctgagcacgacacatatggagtt
agcccaggcgacctattatcgaccattcaatcctccaggttcggccccagatatgagcaa
cctcctgcaaagctacagtctcctctggccgaaaaggagaacacccatttccggcttcct
gccatgcaagcgcgtcatactttccgccgacaagacacgatggacgaggacgcgctgttc
cgcgagtgcatcttggattgcatcatgaaagggatcggtctcacgagtagtactcgtgac
gctttgcgcaaaagcagccattctggcgacgcttctccgaagcttctttcctatgattcc
cgacgtcagaaggcgatcttcaccaacaacgcctttggctttattgacccatacgaaggc
tccggggatggagagacggagtctttgatgtccatgtctgtaacgagtgcaggaggcaca
tcgccagtgatcaacttgcgggaagagctccgtaacgacattgagatcgtctatttcccc
aagggttcggttttggtcgagcagggagagcgccacccagggttgtactacgtgattgat
ggattcttggacgtaggcgtgccgattgtcgaaaaaggggaggatctcgtgggtgtgtcc
aaaccagcagcttcgaaggagtctttcccgacccttaagcggacgacaaccgccaactcg
atcggggcgggcggcacagctgccaacgattctcgccgaagaaagcaatctcggaaatcc
ctgtatctgatcaagcccggtggtattcaaggctacgttggagcagtagcgtcctataga
tcttacaccgacgtggttgccaagacggacgtctacgttggcttcctcccacgggcgtcc
ttggagcgcatcgcggagcggtatccgatcgctttgctgacgcttgcgaagaggctgaca
agtatccttccacgtctgctcctccacatcgatttcgctctcgaatggctacaggtgaat
gccggtcaagttatctaccaccaaggcgacgagagcgacgcaatttatcttgtcttgaat
ggacgattgcggtcagtccttgaaagtccaggcaataaactagccgttattggcgaatac
ggccaaggagaaagcgtgggtgagctcgaggtgatgaccgagtccactcgcccggcaact
cttcatgcgatccgtgataccgagttggccaagttcccaagatcgctcttcaacagcctt
gcccaagaacacccaggaattaccattcaggtctccaaactgattgcgcaacggatgcgg
gatctggtcgaacgcccggtgactgagaaaggcgtcgaacgaagtaacgctggcggtgtg
caaaccgcaacctcgaccgtcaatctccgcaccgtgggcattctgcctgtgacagcgggc
gttccagtggttgaattcggtaatcgactattgcacgctcttcatcaagttggagtgacg
aatggggttacatctctcaaccaggcggccattttgaatcacctagggcgccatgccttc
agcaagatgggcaagctcaagttgtcccaataccttgccgatctagaagagaagtatggc
atggttctttacatcgctgacactaacgtgagctctccgtggacgcaaacatgcatcacg
caggccgattgcattcttctggtcggtctggccgaatcatcccccagtattggagagtac
gagaggttcctgcttggcatgaagactacagctcggaaagagctcgtattgttgcactcg
gagcggtattgtccacctggactaactcggcgttggttgaagaaccgagtatggatcaat
ggcggccaccatcacattcaaatggccttccgactgacggccgagccttcgcatccggaa
accaagcgcttcggaacagtcctcaaacaacgggtccaggtgttgcaggctgaaatccaa
aagtacacatcgcggaggattcgccagacacctctttactccgctcaatccccattcaaa
ggtgatttccatcgccttgcgcgtcggctgtgtggtagagctgttggtttggtgcttggt
ggaggaggagcaaggggtattgcgcacgttggtgtgatcaaggcgctcgaagaggccggt
atccccgttgatatcatcggcggcacatcgatcggttcgtttatcggtgcattgtatgct
cgagatgcagacgtggttcccatgtatggccgtgcgaagaagtttgctggccgcatggga
agcatgtggcggttcgcgctggatctgacgtacccgacggtctcctacacgaccggccac
gagttcaaccgtggaatcttcaagacctttggtgatagccagatcgaggacttctggctc
gagttctactgcaacactaccaacatcagcaaatcgcgccccgagtatcattcgtctgga
tatgtctggcgctatgtccgtgcatccatgtcgcttgcgggtctgattccgccgatttgc
gacgagggaagcatgctcctcgacggcggctacattgacaatctgaccgtcgaccatatg
aagggtctcggtgcggatgtcatcttcgccgttgacgtgggctctatcgatgacaacacg
cctcaagtctatggagactccctctccggattctggtccgtctttaaccgctggaacccg
ttctcctcgtgccccaatcctccaacgttatccgaaatccaggcacgtctggcctatgtc
tcgtctattgacaacctggaacgcgccaagaacatcccgggctgtctgtacatgcgtccc
cctatagatggatacggcacgctggagtttggcaagtttgatgagatctaccaggtcgga
tatgcctttggcaagcaattcctggagaagctgaagaccgaagggtccctccccttgccg
gaggagaccgaggagaagaagaagctgcaacgtacaatggctccccgccgagccagtata
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system