KEGG   Neosartorya fischeri: NFIA_033810Help
Entry
NFIA_033810       CDS       T01070                                 

Definition
dyrk
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
nfi  Neosartorya fischeri
Brite
Enzymes [BR:nfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     NFIA_033810
Protein kinases [BR:nfi01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   NFIA_033810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1314 aa AA seqDB search
MGNLAKSDYNHTPPDQTDFLAPVNFDDFHNSIMAEPSLNHFPMPGTGVSNHPGSQLSGPF
TRNPWADNNESSFASRSRSNSVRRKSEVSRLSSQNSSAESVSSRLPASNTAARSRRQSLV
QNSAANAPAPRAPRKSIGPGSIAAATSARRQSVSARKASVDTSPADHASLRPHAQNLNSN
GLDKTRLPSNVRNMKAKSLQPPSREPGDHLLTASGSTDHSRSCSTNAVRTPIKNPAGSAT
TPASSAKRVSVMPPHATGLGARTISPTDARRMKRISTAPQAPPLPYTPPTKQDTLPVRPR
SCAQSPSSLPRKSVTPSSTRTTPDPSRKSYSSGLSLSSNTSYSSTRNSGSSLQTRFAQNQ
SSSRLPTPKPRAEHTGGNNEEVPPVPAIPKAYESPKGDGDFHTYFAPRKSSLPLDIGLPK
PKVDHDAEHKPATSGNDKKTTDHPAERAMKTPDAKTPASNFGKKNLQPLKLPPLNLLPLS
TPVASKIEALKDREDDAQSYTPSGQVVSKTPSTPMTASKANFSFRDDDDTMDFTHARSST
SHFVLSTSTAAPLRTASSSSALASFDNNTTGGARTISPYVSYTLPKSSSDFSNLQQKANT
SGDYSPRISQSYKLTGPRPQTQSSAFSSNAETVSQLSTPSDPDNNSVSGSSIFNKITLTR
KRSNSKPQRSTGADLDPAKQMPPPRLPASATWNNLTTVKGSSPTLKPAYIQTRRQSSISG
TSVSTMRNPSVSSEQSLALEPSVSNESGESNTASLRSGSSIFSPVHKIINSAKSSTAATP
RQQHESSPDSDILAADEEMRRLASKRKDFETAARNLDELRRKAGPKERVSPAQALKMANL
NIFERGEIIDFKDIYFCGTQNAKKHVGDLNAQAANFGYDDDRGDYNIVIGDHLAYRYEVL
DVLGKGSFGQVVRCIDHKTGALVAVKIIRNKKRFHQQALIEVNLLQKLKEWDPHRRHSVV
NFTQSFYFRGHLCISTELLGMNLYEFIKAHDFKGFSLKLIRRFTKQILGTLTLLHTKKVI
HCDLKPENILLVHPMSSEIRVIDFGSSCFENEKVYTYIQSRFYRSPEVILGMSYGMPIDM
WSLGCILAELYSGYPIFPGENEQEQLACIMEVFGPPEKHLIEKSTRKKLFFDSLGKPRLT
VSSKGRRRRPSSKDLKQVLKCDDDAFLDFISRCLRWDPARRLTPHDALRHEFITGIKPAS
RSRSYGMASLSNKRGTTLSNPTARPLPEPPGTSLKNGTFIRSRDISGSSPVKPTTVGKRH
STVSGLQPSTPAKRGTTVPSTPGSALPRVAARSISGKPDLATAAAATSLVSNLT
NT seq 3945 nt NT seq  +upstreamnt  +downstreamnt
atggggaatctggcaaagtcggactataaccatacacctcctgatcagacggacttcctt
gcccccgtcaactttgatgatttccacaacagcatcatggcagagccgagtctaaatcac
tttccaatgcccggcactggggtttcaaatcaccctggaagccagctctcaggtccattt
acgcggaatccgtgggcggataacaacgaatccagcttcgccagtcggtcaagaagtaat
tccgtgcggagaaaaagtgaggtttcacgtttatcgagccagaattcctccgcagaatcg
gtatcttcgcgtcttccggcttccaacactgctgcgcggagtcgccgccagagtcttgtc
caaaactccgctgcaaacgcccctgctccgcgcgctccacgcaaatccataggccctggc
tccattgcagctgctacatctgccagacgtcagagcgtgtctgctcggaaggcaagtgtg
gacacgtctccagccgaccatgcaagtctccgcccacatgcccagaatctcaattccaac
ggccttgacaagacgaggctcccttccaatgttcgcaacatgaaagccaagtcgctccag
ccaccctcccgagagcctggtgaccatctgttgactgcatctggatcgaccgaccactcc
cggtcatgttccactaatgccgttcggacgccgattaagaatcctgccggtagtgcgact
acgcccgcttcatctgcgaaaagggtgtcagttatgcccccacacgcgacaggcctcggg
gctcgaacaataagccctactgatgcacggcgtatgaagcgaatctctactgcaccgcaa
gcgcctccattaccatatactcctccaaccaaacaggacacgctgcctgttcgcccgcgg
tcctgcgcccagtctccgtctagcctgccgcggaagagcgtcacgccatcgtcgacgaga
acaacgcccgacccgagtcggaaatcctacagttcaggcttgtctttgtcgtccaacacg
agctatagctctacgaggaattccggcagttccttgcagacaagatttgcccagaatcaa
tcgtcttcccggttacctaccccaaaaccgcgtgcagaacacacggggggaaacaacgaa
gaggtccctcctgttcccgcaattcccaaggcttacgagtctcccaagggtgacggcgat
tttcacacctactttgctccgcggaagtctagtcttcccctggatattggtcttccgaag
ccgaaggttgaccacgacgctgagcacaaaccagcgacaagtggtaacgacaaaaagact
acggatcatcctgctgagcgagcaatgaaaacccccgatgcaaagactccggcgagcaat
tttgggaagaagaatctgcagcctttgaaattgccccccttgaacctgttgcctctcagc
actcccgtggcctctaagatcgaagctttgaaggaccgcgaagacgatgcgcagtcctac
actccttcaggccaggtcgtatccaagactccaagcacgccgatgacggcctccaaggca
aatttctcctttcgagacgatgacgacacaatggatttcacccacgctcgaagcagcact
tcccatttcgtgctgagcacctcgacagctgctcctctgaggacagcaagtagctccagt
gcattggcgtcttttgacaataatactactggtggtgcgcgaacaatttccccgtacgtc
tcgtacacgttgccaaagagtagcagcgacttcagcaacctacaacaaaaggccaacacg
agtggcgattattccccacggatctcgcaatcatacaagctgactgggcctcgacctcaa
actcaatcgtccgcattctcttccaatgctgagacagtcagtcaattgtctactccttcg
gatcctgacaacaacagcgtttctggctcttcaatcttcaataaaatcactctgaccaga
aagcgtagcaactccaaaccacaacgttcgacaggtgctgatctggatccggcgaagcaa
atgccgccgcctagactcccagcatctgccacctggaataacctgaccacagtcaaaggc
tcgagtcccacgctcaagcccgcgtacattcaaacaagacgtcagtcatctatttccggc
acgagtgtctcaacaatgcggaacccaagtgtgagcagtgaacagagtctcgctttggag
ccaagcgtctcgaatgagtccggggaaagcaatacggcatcactccgatccggatcatca
atcttttcgcccgtgcacaagataatcaattcggcaaagtccagcacggcagccacccct
cgccagcagcatgagtctagccctgactctgacattttggcagccgacgaggagatgcgc
agactcgctagcaagcgcaaggactttgagactgccgccaggaatctggacgaattacgc
cgcaaggcaggcccgaaagagcgagtgagcccagcgcaggcactgaaaatggccaatctc
aatatctttgaacgtggggagatcatcgacttcaaggatatctacttctgcggaacgcag
aatgcgaagaaacatgttggtgatctgaacgcgcaagctgccaacttcggctacgacgac
gatcgtggtgactacaacatcgtgatcggtgatcatcttgcgtatcggtatgaagtgctc
gatgttctgggcaaaggtagctttggtcaggttgtgagatgcatcgaccacaagacggga
gctctggttgctgtgaagatcattcgcaacaagaaacggttccaccaacaagctctgatc
gaggtgaacctcctccagaaactcaaggagtgggatccgcatcgccgtcacagcgtggtt
aatttcacacagagcttctacttcaggggacatctctgtatctccacggaactgctcgga
atgaacctttatgaattcatcaaggctcacgacttcaaagggttctcactcaaactaata
cgccgcttcacgaagcagatcctgggcactctgacactcctgcacaccaagaaggttatt
cattgtgatctcaagcccgagaatatccttctcgttcatcccatgagctccgaaatccgg
gtcatcgattttggatccagttgtttcgagaatgagaaagtgtatacctatatccaaagt
cgtttttaccgctcgccagaggtcattcttggcatgtcttatggcatgccgattgatatg
tggagtctggggtgtatcttggccgagctctacagcggctatcccatcttcccgggagaa
aatgaacaggagcagcttgcttgtataatggaggtgtttggtcctcccgagaaacattta
attgagaagagcactcggaagaagttattctttgattctttgggcaagcctagactcacc
gtctcttcaaagggcagaaggcgtcgacccagttcaaaggacctcaaacaggttttgaag
tgtgacgatgatgcgttccttgactttatctctcgctgtcttcgatgggatcccgctcgt
cgcctcacccctcacgatgcgctcagacacgagttcatcactggaatcaaacctgcgtca
cgctctcgaagctatggtatggcgagcctatcaaacaagcgtggcaccactctgtctaat
cccacagcacggccgctgccggagccacctggaactagtctcaaaaacggtacatttatt
cgcagtcgcgacatttcaggcagctctcctgtgaagccgacaacagttggtaaacggcac
tccaccgtgagcggcctgcagccgtcgactcctgccaagcgaggcacaactgtcccttct
actcctggttcagcgttaccccgtgtcgcagccaggagcatcagcgggaagcctgacctc
gcgactgcggcggcagcgacgagtctagtaagtaatctgacctag

DBGET integrated database retrieval system