KEGG   Neosartorya fischeri: NFIA_034910Help
Entry
NFIA_034910       CDS       T01070                                 

Definition
meiotic regulator-interacting protein, putative
Orthology
K07204  
regulatory associated protein of mTOR
Organism
nfi  Neosartorya fischeri
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1435 aa AA seqDB search
MRDPTINMEQDIAAKPQATSLQAEPRKNQKSVRVAFGPDLDTYIPPRDKSPAPSSGHHRS
YTTVEHSQPSISSLHRPASSSAGDNAAVFEPSPRLTSDRASDSNGRPTAALKRARSDYGP
RLGFDKSAVADEEEDFAMRHGWQEEYTSSEYLKVLHSNFYMYFTEKRHDTNGIPRDPVGS
WPSQDWRMKDRLKTVSAALAICLNIGVDPPDVVKTNPSAKLECWVDPTSTTGGGQNKIME
QIGKKLQEQYETLSLRTRYKQYLDPSVDETKKFCISLRRNAKDERVLFHYNGHGVPLPTQ
SGEIWVFNKNYTQYIPVSLYDLQSWLAGPSLFVFDVSHAGNIVQNFHTFVEKHEKENLEA
KKRDPNAVVQNYGDCILLAACQKNESLPTNPDLPADLFTCCLTTPIEIALRYFILQNPLQ
TNLSIDEFRVPGRLQDRRSPLGELNWIFTAITDTIAWNTLPRALFKKLFRQDLMVAALFR
NFLLSERIMRTYKCHPISSPELPETHHHPLWKSWDLAVEMVLSQLPALIDHEEGRRQYEY
QHSTFFAEQLTAFEVYLSSGPTEKNPPDQLPIVLQVLLSQAHRLRALILLSKFLDLGPWA
VHLALSIGIFPYVVKLLQSAAQELKPVMVFIWARIMAVDHTVQNDLLKDNGIHYFISILN
PSSPIPVGNASEHRAMCAFIVSIFCKNYPQGQNVCLSGELFDSCLKHLTDVENPLLRQWS
CLCISMLWSDFPEAKWMGIRCAAPARLCELNFDPVPEVRAAMLHAATTFLGIPDLTDQVA
QIEESLALAVLPMASDGSVLVRKELLVFFSTFVKRYQNKFLVAAYEEFQDEKQTLLLRLE
HDGSRGFTLEDVQNGAANSSNKSQKLSQSTTFGTIWKQLLILSVDPHPDIAQDASTIIDY
IHLTLLASPMASLTDKARKEIMELTSRLSQKLQVRERAESKKAAPPPAPPSQTAAPKQEG
YLSLSIKRTASVAASLKNLAFGGPSQTEQQSSQSVTSPTKSRTPVTPRGRAPPEWTRPPE
VNDQVASAAAYHQAPIPTSRGFEPRDPSLAPMIPLLSRFLDWSTEYFREPQMKPNEPDEP
GSADYNERLWRRSRNEKIITETQPLKGKAGSSRWDNSLALLTNTSQPLKMCFHQFEDHLA
VADDRDTIAIWDWQRHKRLNRFSNGNPPGSRINEVRYINEDDQALLMTGSSDGVLKVFRN
YESPKEVEIVTAFRALPELIPSNRNAGLVFDWQQGQGKALVAGDVKVIRVWNAATEVCTN
DIPARSGSCITSLTSDQVAGNIFVAGFGDGAVRVFDQRLKPTTSMVKVWREHKQWIANVH
MQRGGLRELVSGSRNGEIRLWDLRMDDPISTIYATKDTLRTLSVHEHAPVFMVGTNRHEV
KTFNMDGTYLSTFEPYSSFLHHNRSSPIASTAFHPHRTILACAALNDNHINLVSC
NT seq 4308 nt NT seq  +upstreamnt  +downstreamnt
atgagggatcccaccatcaacatggagcaagacattgcagcgaagccacaggcgacaagc
cttcaagctgaaccacgcaagaatcaaaagtccgtccgtgtcgctttcggtccggatttg
gacacttatattcctccgcgcgataagtcacccgcgccttcctcaggccaccacagatct
tacaccactgttgaacattcgcaaccatctatatcgtcgcttcaccgtccagccagttca
tcagcaggagataatgcggcagtcttcgagccgagtcctcggttgacgtcagatcgagct
tcagactcgaacggaagaccaacagcagctctgaaaagggctcgaagtgactatgggccg
agattgggattcgacaagtccgctgttgccgatgaggaagaagactttgccatgcgacat
gggtggcaggaggagtatacctcgagcgagtaccttaaggttctacactcgaacttttat
atgtacttcacagagaagcggcacgatacgaacggcatcccaagagacccagttggaagc
tggcccagtcaggattggcgcatgaaggatcgtttgaagacagtttcggctgccctcgcc
atctgcttgaacatcggtgtcgatcctcctgacgtggtgaagacgaacccatcagccaag
ctggaatgctgggtggatcctacatcgaccacgggcggcggccagaacaagataatggag
cagattggaaagaagctgcaggagcagtacgaaactctcagcttaagaactagatacaag
cagtatcttgatccttcagttgatgagacgaaaaagttctgcatttctctgcgccgtaac
gctaaggatgagagagttctctttcactacaacggtcacggtgttccgttgcctacacaa
tcgggagaaatctgggtgtttaacaagaactatacccagtacattccagttagtttgtat
gatttgcaatcctggctcgctggtcccagcctcttcgtttttgatgtttcccacgccggg
aacatcgtgcagaatttccacacttttgtggagaagcacgaaaaggagaaccttgaagcc
aaaaagcgtgacccgaacgccgtggttcagaactatggggattgcatccttctggcagct
tgtcagaagaacgagtcactacctaccaatcccgatcttcccgcagaccttttcacctgc
tgcctgaccacacccatagaaatagcgctgcgctacttcattctccagaatcccctccag
acgaatctctcaattgacgaattcagagtccctggtcgtttgcaggaccgcagaagccct
ctcggcgagttgaactggatcttcaccgcaatcactgacaccattgcatggaacacattg
ccacgggcattgttcaagaagcttttccggcaagatttgatggtggctgcacttttcagg
aattttcttctcagcgagcgcatcatgcgcacgtacaagtgtcacccgatatcctcaccc
gaactcccagagactcatcatcatccgctttggaaaagctgggatctggctgttgagatg
gtgctatctcagctaccagctctcattgaccatgaagagggccgcagacaatacgagtac
caacattccacctttttcgcggagcaactcactgcttttgaagtctacctctcatccggc
ccaaccgagaagaacccgccggatcaactccctatcgttctgcaagttctacttagccag
gcacatcgactaagggccctcatcctcttgagtaagtttctcgacttgggaccgtgggct
gttcatctcgctttgagcatcggtatcttcccgtatgtcgtcaaactgctacagtcagca
gcccaagagctgaaacctgtcatggtattcatttgggcgcggattatggcagtggatcac
actgttcagaacgatctgttgaaggacaatgggatccattatttcatctctatccttaac
ccttcgtcacccattcctgtgggtaacgcgagtgagcatcgagcaatgtgtgctttcatt
gtttcgatattttgtaagaattatcctcagggacagaatgtgtgcctttctggcgagctt
tttgactcttgtctgaagcatttgactgatgtggaaaatcctttactccgacaatggtca
tgtctctgcatcagcatgctctggtccgactttcccgaagccaagtggatgggaatccgg
tgtgctgcacccgcaagactctgtgagctcaattttgaccccgttccggaggtcagggca
gcgatgctccatgcagcgaccacattcttaggcatccctgatttgaccgatcaggtggcg
cagattgaagaatccctggctttggctgtgctgcccatggcatcagacggtagtgtcctg
gtgagaaaggagctccttgtcttcttctcgacctttgtcaaacgctaccagaacaaattc
ctggtcgccgcatatgaagagttccaggacgagaagcaaacccttctccttcggttagag
cacgacggctctcgagggttcacgttggaagatgtgcagaatggagctgccaactcaagt
aacaaatcacagaaattgtcgcagagtaccacgtttggcacgatctggaaacaacttctt
atactctctgttgacccacatcctgatattgcgcaagacgctagcacgattattgactac
atccacctcacccttctagcgtctcccatggcgtcgcttactgacaaggcccgaaaggaa
atcatggaactcactagccggttgtcacagaaattacaagttcgcgaaagagcggaatcg
aaaaaggccgcgcctccaccagctcctccttcccagacggctgctcccaaacaggaagga
tacttgtcattgagcatcaaaagaacagccagtgtggccgcttcactcaagaaccttgct
ttcggtggaccctcccagactgagcaacaatcatcgcagagcgtaacatcgcccacaaag
agccgcacgcccgtcacccctcgaggacgtgctccccccgaatggacccggcctccggaa
gtcaacgaccaggttgcttccgcggcagcttatcaccaggctccaattcctacctcgcgc
ggtttcgaaccccgagacccatctctggcccccatgataccccttctgagtcggtttctt
gattggtccacagagtatttccgtgagccccagatgaagcccaatgagcccgacgaacct
ggtagcgccgactacaacgagcgcctctggagacgtagccgcaacgagaagatcatcacg
gaaacccagcccctcaagggaaaagcaggcagcagtcgctgggataactctttggccctg
cttactaataccagtcagcccctgaagatgtgtttccatcaatttgaggatcacctcgca
gttgcggatgaccgggacacgatcgcaatctgggactggcagagacacaagcgtctcaat
aggttttccaacgggaacccgccgggctcgaggatcaacgaagttcgttacattaacgag
gacgatcaagcgttgctgatgaccggatcctccgacggggtactcaaggtattcagaaat
tacgagtccccgaaagaggtggagatagtgacagctttccgtgctttgccggaactaatt
ccaagcaatagaaatgctggtctggttttcgattggcagcaaggccaaggcaaagcactg
gttgctggggatgtgaaggtgatccgtgtgtggaacgcggccactgaagtctgcaccaac
gacatccctgctcgctcagggtcttgcattacctcccttacttccgaccaggtggcaggg
aacatctttgtggccggattcggcgacggtgcagtccgcgtgtttgatcagcgtctaaaa
cctacgacctcgatggtgaaggtttggcgtgagcacaagcaatggatcgccaatgtccac
atgcaacggggtggattgagggagctcgtgtccggtagtcgaaatggcgagattagattg
tgggatcttcgcatggatgaccctatctcaacaatctatgccactaaagataccctcagg
acgttgagtgttcacgagcacgctcccgtatttatggtcggcacgaatcgccatgaggtc
aagacattcaacatggatggaacatatctgtccacgttcgaaccatactcaagcttcctg
caccacaaccgctcttccccaattgccagcactgccttccacccacatcgtaccattctt
gcctgcgccgcgcttaatgataaccacatcaaccttgtgagttgctag

DBGET integrated database retrieval system