KEGG   Neosartorya fischeri: NFIA_035460Help
Entry
NFIA_035460       CDS       T01070                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
nfi  Neosartorya fischeri
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NFIA_035460
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     NFIA_035460
Exosome [BR:nfi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NFIA_035460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 607 aa AA seqDB search
MARDEPLLAPRPSSENNSIRNAEEEDALLTGERTGRGQERRGWTFWREVGLFSWALLATI
AVIVLAVVYQHETSKPNVGSRPPWGPGGKPTGKRNLIFMVSDGMGPTSLTMTRSYRQFTE
GLPIDDILVLDGHIIGTSRTRSSSSLVTDSAAGATAFSCGFKSYNGAISVLPDHSPCGTV
LEAASLAGYKTGLVVTTRITDATPACFASHVNMRQYEDRIAEQEIGEHPLGRVVDLIFGG
GRCHFLPNSTDGSCRADDRDLVSVAKENGFSYLDDRKGFDSLNGGSEAKLPLLGLFAEKD
IPFEIDRRIQNDVYPSLEEMARTALKILSDATADSEQGFFLMIEGSRIDHAGHGNDPAAQ
VHEVIAYDKAFAAVLDFLEKDSTPGVVVSTSDHETGGLAAARQLHTTYPEYKWLPGVLAN
ASHSTEYIDNKLREFLSTETKKNKQQRYVRELLEKGLGITDATDEEIDSILDPNSPVSSQ
YQFADIISRRAQIGWSTHGHSGVDVNIYASSSKDAWPLVGNHENTEIGQFMADYLDLDVE
NITKHLQSSSAWSFAGGEVDRPFAWLGDPLGANVRTEGFDTYHGEFRKRSMDVDGMEKRE
CGCGGMH
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgggacgagcctcttctggctccgcgcccttcttcggagaacaactccattcgg
aatgcggaagaggaggacgcactgttgaccggggagcggaccgggcgaggccaggagcga
cggggttggactttctggcgagaagtcggtctgttcagctgggcgctcctagctacaatt
gctgttattgtgctcgcagtcgtctaccagcatgaaacgagcaagccgaacgttggctcg
agacccccctggggtccgggagggaagccgaccggcaaacgcaacctaatcttcatggtg
tcggacggaatgggccctaccagtcttaccatgaccagaagctatagacaattcacggag
ggattaccgattgacgacattttggttctggacggccacatcattggaacttcgaggacg
aggtcgagttctagcctggtaacggattcggcagccggtgctacggctttctcttgcggt
ttcaagagttacaatggtgccatctctgtgcttccggatcattcaccctgtggaaccgtc
ctcgaggctgcgtcgttggccggctacaagaccggacttgttgtgacgactcggatcacc
gatgccacccctgcttgttttgcgtcgcacgtgaacatgcggcaatacgaagaccggatt
gccgagcaggaaatcggcgagcacccactcgggcgcgtggtcgatcttatctttggtggt
ggtcgttgccatttcctgcccaattcgaccgatgggagctgccgggcagacgatcgcgac
ttggtcagtgtcgcaaaggagaatggattcagctaccttgatgataggaagggctttgac
tcgctgaatggcggatcggaggccaagctgcccctcctgggtctgttcgcggagaaggac
attccgtttgagattgaccgtcgtattcagaacgacgtctacccgtccctggaagagatg
gcccgcaccgcactcaagatactcagcgatgctaccgctgatagcgagcaggggttcttc
ttgatgatcgaaggttctcgtattgatcatgccggacacggcaatgatcccgcagcgcag
gtccacgaggttattgcgtacgataaggcattcgctgcagtgctggacttccttgagaaa
gactcgacgcccggtgttgtggttagcacatctgaccatgaaacgggtggcctggcggcc
gctcggcagctgcataccacctacccggagtacaagtggcttcctggggttctggccaac
gccagccattccaccgaatacattgacaacaagcttcgggagtttctctctacggagacg
aaaaagaacaagcagcaacgttatgtccgagagctcttggagaagggtctaggtattacc
gatgccacagacgaggagatcgattctatcctcgatccaaattcgccggtaagctcgcag
tatcagtttgccgacattatcagtcgaagagcccagatcggctggtcaacccacggccac
tctggtgttgacgtcaacatctatgcatcctcttctaaagatgcctggcccctggttggg
aaccacgaaaataccgagatcggccagttcatggcagactacctcgacctggacgtggag
aacatcaccaagcacctacaatcatccagcgcctggtcgttcgccggcggtgaagtagac
cggcccttcgcctggctaggggatcccttgggcgcgaacgtccgcaccgagggctttgat
acctaccacggagagttcaggaaacgctcgatggacgtggacggcatggagaagagggag
tgcgggtgcggagggatgcactga

DBGET integrated database retrieval system