KEGG   Neosartorya fischeri: NFIA_035590Help
Entry
NFIA_035590       CDS       T01070                                 

Definition
alpha-amylase AmyA
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
nfi  Neosartorya fischeri
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NFIA_035590
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     NFIA_035590
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 311 aa AA seqDB search
MTDRFARTDGSTTHPCNTTEGLRCGGSWRGTIQHLDYIQGMGFDAIMISPIVQNVEGRVQ
YGEAYHGYWVQDMYALNPHFGTHQDMLDLSKAVHDRGMYLMVDTVVNNLAYITNGRNPAT
SIDYSTLSPFNDPVFFHPYCKITDYDNYPLAQTCWTGDDVVPLPDLKTEDSQVQSMLMDW
IRKMMTTYSIDGLRLDAAKHITPSFLPLFDNASGAFITGEVFEPSVKTICGYQNDLPSVP
NYPIYYSILEAFTKGNTSSLTNQVEVMKQTCSDVTALTSFSENHDVARFASFKDDIAVRQ
RTRVTLTSINR
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgacagacagatttgcacgtacggatgggtccaccactcatccatgcaacaccacagaa
gggctacgctgtggtggttcatggagaggtacaattcaacacctcgattacattcaagga
atgggattcgacgctatcatgatctccccaatcgtccagaatgtcgagggacgcgtgcag
tacggagaagcctatcatggctactgggtccaggatatgtatgcgctaaacccacacttt
ggcactcaccaggacatgctagacttgagcaaggctgttcatgaccggggcatgtatttg
atggtagatactgtcgtcaacaacttggcgtacatcaccaacggacgaaacccggccacg
agcattgactattcaacgctcagcccattcaatgacccagtgttcttccatccatattgc
aagatcaccgactatgacaactatccattggcgcaaacttgctggacaggtgatgatgtt
gttcccctcccagatctaaagacagaagatagccaagttcagagcatgctcatggactgg
attagaaaaatgatgactacgtattcaatcgatggtctacgtctggatgcagcgaagcat
attacaccaagcttcttgcccttgttcgataacgcttctggcgctttcattactggcgaa
gttttcgagccatccgtgaagacgatctgcggatatcaaaatgacctccccagcgtcccc
aattatcccatctattattccatcttggaggcatttacaaaaggcaacacaagctctctg
acgaatcaggtagaggtcatgaaacagacatgttctgatgttactgcccttacttcgttc
tcggaaaaccacgacgtcgcccgatttgcaagcttcaaggatgacatcgcggtaaggcag
cgaactcgagttaccctgacaagtatcaaccgatga

DBGET integrated database retrieval system