KEGG   Neosartorya fischeri: NFIA_036960Help
Entry
NFIA_036960       CDS       T01070                                 

Definition
histone acetyltransferase, putative
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
nfi  Neosartorya fischeri
Brite
Enzymes [BR:nfi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     NFIA_036960
Transfer RNA biogenesis [BR:nfi03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    NFIA_036960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 576 aa AA seqDB search
MATLTMTMPPPSKPKKGNEKLPPENERYMRACSDIANVLIQEYEAQRDSSKPRKDINLNK
LRGQIAKKHRLATQPPLTAIIAAVPEQYKKYILPKLIAKPIRTSSGIAVVAVMSKPHRCP
HIAYTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFEQARGRVDQIKSLGH
SVDKVEYIVMGGTFMSLPPDYRESFIAQLHNALSGYQTDNVDEAVQAGEMSNIKCVGITI
ETRPDYCLDTHLSDMLRYGCTRLEIGVQSLYEDVARDTNRGHTVAAVAETFKLAKDAGFK
VVSHMMPDLPNVGMERDLFQFQEYFENPAFRTDGLKIYPTLVIRGTGLYELWRTGRYKNY
TPNALVDLVARILALVPPWTRIYRVQRDIPMPLVTSGVENGNLRELALARMKDFGTTCRD
VRTREVGINEVKNKIRPSQVELIRRDYTANGGWETFLAYEDPKQDILIGLLRLRKCSTTH
TFRPEFTGQQTSIVRELHVYGSAVPLHGRDPRKFQHRGFGTLLMEEAERIAREEHGSRKI
SVISGVGVRSYYARLGYTLDGPYMSKMLDPIEDEEF
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccctcaccatgacaatgccgccaccatccaaacccaagaagggcaacgagaaa
cttccaccagaaaatgaacgttatatgcgagcttgctctgatattgcaaacgtgctcatt
caggaatatgaagcgcagagggattcatccaaaccgaggaaagatatcaacctcaacaag
ctgcgcggccaaatcgcgaagaagcatcgcctggctacgcaacctcccttgacagctatt
atcgccgccgtgccggaacaatacaagaaatatatcttacccaagctcatcgcgaagcct
attcggacgtcgtcgggaattgccgttgtcgccgtgatgagcaaacctcaccgttgtccg
catattgcctacaccggtaacatttgtgtctactgccctggtggacctgattcggatttt
gagtattcgacacagtcatatactggctacgagccgacatcgatgcgcgctatccgagca
cggtacgatccgtttgaacaagcgagaggtcgggttgatcagatcaagtctctcggccat
agcgtggacaaagtggaatatattgtcatgggtggcacattcatgtctcttccgccggat
tacagagaatccttcatcgctcagcttcacaatgcgctgagtgggtaccagacggacaat
gttgacgaggctgttcaggcaggcgaaatgagcaacataaaatgcgtgggtattacgatc
gagacgcggcctgattactgtttggatactcatctgagtgatatgcttcgatatgggtgc
acgcgattggaaattggcgtgcaaagtttgtatgaagatgttgcgcgggatacgaatcga
ggccatactgtcgctgcggtggcagagacattcaagctcgccaaggatgctgggttcaag
gtcgttagccacatgatgccggatctgccgaatgtcggcatggaacgggatcttttccag
tttcaggaatattttgaaaacccagccttccgtacggacggtctgaagatttatccgaca
ctggtcattcggggtacaggcctgtatgagctttggaggacgggtcgctacaagaactac
acccccaacgcgctggtagatcttgtcgctcgaatccttgcgctagtacctccgtggacg
cgtatctaccgtgtgcagcgagatattcccatgcctctggtcacttccggcgtggagaat
ggcaaccttcgagaactggctttggcacgcatgaaagactttggtacaacatgtcgtgat
gtgcgcacccgcgaagttggtatcaatgaagtaaaaaacaaaatccgcccctcgcaagtg
gagctcatccgtcgagactatactgccaacggtggttgggaaacgttcctcgcctatgaa
gatcctaagcaggatattctcatcggcttactgcgcctgcgaaagtgcagcacgactcac
actttccgtccggaattcactggccagcagacgagtattgtgcgagagctccacgtatat
ggctctgcggtaccgctccacggccgcgatccgcggaagttccagcaccgaggatttgga
accttgctaatggaggaggccgagcggatcgcgcgagaagaacacggaagccgaaagatc
agcgtcatctcgggagtcggtgtccgcagctactatgctcgtctcgggtacacactggac
ggtccttacatgtccaagatgctcgacccaattgaagacgaagaattctaa

DBGET integrated database retrieval system