KEGG   Neosartorya fischeri: NFIA_038250Help
Entry
NFIA_038250       CDS       T01070                                 

Definition
alkaline phosphatase family protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
nfi  Neosartorya fischeri
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:nfi00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 660 aa AA seqDB search
MVSLPRIAAATSSAILRLATFVFLRWVPGHHFPPIIFTSLAVYLASLRSLIYQDVESAAP
RNSGKNARDSRKIERTSKAQPLTTLLTGLPCTRSPLATRLTALVNIVLTLLTLDFMLRGV
VFHSGQSLTFSRIGYVSPTTANLLVREPDSAQLPLVVYYQEILEDDPSKWVEEGIIYSLD
DSTDYTTSVTIQGLKPASSYRYSLSNKETGTFVAAPLPGTESANRLAFVTSSCMKQNFPY
NPLSHSLRIPGIETMTETLGKLPDLLRPAFMMFLGDFIYVDVPQRFGSSVSHYRSEYRRV
YSSPSWSKNDAIGLPWIHTLDDHEIANDWSKGNTTAPYPAAADPYIHYHVSVNPPIPPMA
FAKPENTTYFSFIHGPASFFMLDTRTYRSEPAQVNSTMLGSAQLQSLLAYLARPEPAEVR
WKIVASSVPFTKNWHVGTTDTWGGFLHERRTVFEAMWRAERELGVRVVLLSGDRHEFGAT
RFPDPTLDYTGEDLLAHTAGEGVHEFSVGPLNMFYLPIRTYRQTDTEDVAVKYVPDGNVK
YGHVDISVQDEQIDTASGTPVTVPSSVLTYTLYVEDQVVWKYKLSVPLPEYDSLMQASSS
KHPRLPPGKVLVDNREAEGWHAAIQTMVGRFEEAARQFAHRALDEFYELLDKTERAERLD
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atggtgtctctcccgcggattgccgccgcaacgagttccgcgatcctcaggttggcgacc
tttgtattcctacgatgggtccctggtcatcatttcccgcctattatcttcacatcattg
gcagtgtatctcgcgtcactgcggtccttaatctatcaggacgtcgagagtgctgctccg
cgcaatagtggaaaaaatgcccgagactcgagaaagattgagcgcacatctaaagctcag
ccgcttacgacgctgttgaccggtttgccctgtactcggtcgcccctagcgacgcgcctg
acagccttggtgaacattgtgcttacgctcctgactcttgactttatgctacgaggtgtg
gtattccactcaggccagagtctcaccttttcacgcatcggttatgtctcccctaccacg
gccaatctgctggtacgagagcctgactccgcgcaacttccccttgtagtctactatcaa
gagatcttggaagatgacccgtcgaaatgggtcgaagagggtattatctattcactggat
gactcgaccgattacacgacgtccgtgaccatccagggcctgaagccggcctccagctac
cgctattccctttccaacaaggaaacaggcaccttcgtagcagctcctctgccaggcacg
gaatcggccaacagactggccttcgtgacgtcgagctgtatgaaacagaacttcccgtac
aacccgctctcgcactcgctccgcattcccggcattgagacgatgaccgagacactgggc
aaactgcctgacctgctccgtcccgcgttcatgatgttcctcggcgacttcatctacgtc
gatgtgccacagcggtttgggtcgtccgtgtctcattaccgtagcgagtatcgcagggtg
tattcgtcgccatcatggtccaaaaacgacgccattggcctcccctggattcatacgctc
gatgaccacgagattgccaatgactggtccaaaggaaacaccaccgcgccctatccagcc
gccgctgacccatatatccattaccatgtcagcgtgaatcctcccatcccaccgatggca
ttcgccaaacctgagaacaccacgtacttctcgtttatccacggcccggcctccttcttc
atgctcgacacgcgcacctatcgttccgagcccgcgcaagtcaactctactatgctggga
tccgcccagcttcaatccctcctcgcgtacctcgcccgccccgaacccgcggaagtccgc
tggaagatcgtcgcctccagcgtccccttcaccaagaactggcacgtcggcaccaccgac
acctggggcgggttcctgcacgagcgccgcaccgtcttcgaagccatgtggcgtgccgag
cgcgagctcggcgtccgcgttgtccttctcagcggcgaccgccacgagttcggggccacc
cgcttccctgacccgacgctggattacaccggcgaggatctcctcgcgcacacggcggga
gaaggcgtccacgagttcagcgtcggcccgctgaacatgttctatcttcccatccgcaca
taccggcagaccgacaccgaggatgtggcggtcaagtacgtccccgacggcaacgtcaag
tacggccatgtggacatcagcgtccaagacgagcagatcgacaccgcgtctggtacgccg
gtgacggtcccgagctctgtcctgacatataccctctacgtggaggaccaggttgtgtgg
aaatacaaactcagcgttcccttgcccgagtacgattccctgatgcaagcgtcgtcctcg
aagcatccgcgactgcctcctggcaaggttttggtcgacaatcgggaagcggaagggtgg
catgctgcaatccagaccatggtgggtcggtttgaggaggcggcccgccagtttgcacac
cgggccttggacgaattctatgagttgctggataagaccgagagagcggagagattggat
tga

DBGET integrated database retrieval system