KEGG   Neosartorya fischeri: NFIA_038250Help
Entry
NFIA_038250       CDS       T01070                                 

Definition
alkaline phosphatase family protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
nfi  Neosartorya fischeri
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NFIA_038250
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     NFIA_038250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 660 aa AA seqDB search
MVSLPRIAAATSSAILRLATFVFLRWVPGHHFPPIIFTSLAVYLASLRSLIYQDVESAAP
RNSGKNARDSRKIERTSKAQPLTTLLTGLPCTRSPLATRLTALVNIVLTLLTLDFMLRGV
VFHSGQSLTFSRIGYVSPTTANLLVREPDSAQLPLVVYYQEILEDDPSKWVEEGIIYSLD
DSTDYTTSVTIQGLKPASSYRYSLSNKETGTFVAAPLPGTESANRLAFVTSSCMKQNFPY
NPLSHSLRIPGIETMTETLGKLPDLLRPAFMMFLGDFIYVDVPQRFGSSVSHYRSEYRRV
YSSPSWSKNDAIGLPWIHTLDDHEIANDWSKGNTTAPYPAAADPYIHYHVSVNPPIPPMA
FAKPENTTYFSFIHGPASFFMLDTRTYRSEPAQVNSTMLGSAQLQSLLAYLARPEPAEVR
WKIVASSVPFTKNWHVGTTDTWGGFLHERRTVFEAMWRAERELGVRVVLLSGDRHEFGAT
RFPDPTLDYTGEDLLAHTAGEGVHEFSVGPLNMFYLPIRTYRQTDTEDVAVKYVPDGNVK
YGHVDISVQDEQIDTASGTPVTVPSSVLTYTLYVEDQVVWKYKLSVPLPEYDSLMQASSS
KHPRLPPGKVLVDNREAEGWHAAIQTMVGRFEEAARQFAHRALDEFYELLDKTERAERLD
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atggtgtctctcccgcggattgccgccgcaacgagttccgcgatcctcaggttggcgacc
tttgtattcctacgatgggtccctggtcatcatttcccgcctattatcttcacatcattg
gcagtgtatctcgcgtcactgcggtccttaatctatcaggacgtcgagagtgctgctccg
cgcaatagtggaaaaaatgcccgagactcgagaaagattgagcgcacatctaaagctcag
ccgcttacgacgctgttgaccggtttgccctgtactcggtcgcccctagcgacgcgcctg
acagccttggtgaacattgtgcttacgctcctgactcttgactttatgctacgaggtgtg
gtattccactcaggccagagtctcaccttttcacgcatcggttatgtctcccctaccacg
gccaatctgctggtacgagagcctgactccgcgcaacttccccttgtagtctactatcaa
gagatcttggaagatgacccgtcgaaatgggtcgaagagggtattatctattcactggat
gactcgaccgattacacgacgtccgtgaccatccagggcctgaagccggcctccagctac
cgctattccctttccaacaaggaaacaggcaccttcgtagcagctcctctgccaggcacg
gaatcggccaacagactggccttcgtgacgtcgagctgtatgaaacagaacttcccgtac
aacccgctctcgcactcgctccgcattcccggcattgagacgatgaccgagacactgggc
aaactgcctgacctgctccgtcccgcgttcatgatgttcctcggcgacttcatctacgtc
gatgtgccacagcggtttgggtcgtccgtgtctcattaccgtagcgagtatcgcagggtg
tattcgtcgccatcatggtccaaaaacgacgccattggcctcccctggattcatacgctc
gatgaccacgagattgccaatgactggtccaaaggaaacaccaccgcgccctatccagcc
gccgctgacccatatatccattaccatgtcagcgtgaatcctcccatcccaccgatggca
ttcgccaaacctgagaacaccacgtacttctcgtttatccacggcccggcctccttcttc
atgctcgacacgcgcacctatcgttccgagcccgcgcaagtcaactctactatgctggga
tccgcccagcttcaatccctcctcgcgtacctcgcccgccccgaacccgcggaagtccgc
tggaagatcgtcgcctccagcgtccccttcaccaagaactggcacgtcggcaccaccgac
acctggggcgggttcctgcacgagcgccgcaccgtcttcgaagccatgtggcgtgccgag
cgcgagctcggcgtccgcgttgtccttctcagcggcgaccgccacgagttcggggccacc
cgcttccctgacccgacgctggattacaccggcgaggatctcctcgcgcacacggcggga
gaaggcgtccacgagttcagcgtcggcccgctgaacatgttctatcttcccatccgcaca
taccggcagaccgacaccgaggatgtggcggtcaagtacgtccccgacggcaacgtcaag
tacggccatgtggacatcagcgtccaagacgagcagatcgacaccgcgtctggtacgccg
gtgacggtcccgagctctgtcctgacatataccctctacgtggaggaccaggttgtgtgg
aaatacaaactcagcgttcccttgcccgagtacgattccctgatgcaagcgtcgtcctcg
aagcatccgcgactgcctcctggcaaggttttggtcgacaatcgggaagcggaagggtgg
catgctgcaatccagaccatggtgggtcggtttgaggaggcggcccgccagtttgcacac
cgggccttggacgaattctatgagttgctggataagaccgagagagcggagagattggat
tga

DBGET integrated database retrieval system