KEGG   Neosartorya fischeri: NFIA_038880Help
Entry
NFIA_038880       CDS       T01070                                 

Definition
ubiquitin C-terminal hydrolase (HAUSP), putative
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
nfi  Neosartorya fischeri
Brite
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     NFIA_038880
Peptidases [BR:nfi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   NFIA_038880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1123 aa AA seqDB search
MDNVADNEMLVDEYEQYHNDRTDDVVVSRSGSEEPEPEPLADDFPAMMARILPKDPDLET
ADEAYHTWHIQDWRKLKKKEHGPVFQCGGFPWRVLFFPYGNHVDYASFYLEHAWEKEPPE
NWYACVQFALVLWNVNDPSIYVSHVATHRFNADEGDWGFTRFCELRRLFNMPWEGRGVPL
VQNDEAKVTAYVRVVKDPTGVLWHSFQNYDSKKETGMVGLKNQGATCYLNSLLQSLYFTN
AFRKAVYQIPTEAEATRENSAWTLQRLFYNLQTSESSVSTTELTASFGWESRQIFEQQDV
QELSRKLMERLEEKMKATPVEKALPELFVGKTKTYISCINVDYESSRVEDFWDIQLNVRG
NKTLDDSFKDYIQVETLEGENKYDAGSPYGLQDAKKGVIFESFPPVLHLHLKRFEYDINR
DAMMKINDRHAFPMEFDATPYLSDAADKSEPCIYQLHGVLVHSGDLNAGHYYAFLKPTKD
GHWYKFDDDRVTRATDKEVLEENYGGEYELSNGAAGVRQPHTRGLSTKRSMNAYMLVYIR
KTRLDDVLLPITKDDIPSHIEKRLVEERAELLRRKKEREEAHLYINVGVLSDESYKSHHG
FDLTSTDLPAGDPALPKQYRILRAKKVGEFVEQLAEERGLNANQIRLWVMVNRQNKTTRP
DQAIKDREMTVEEAYNRFGTKGNPFKVWMEVGQPSADGTISWPDSSTSVLVFLKNFDVPS
QTLSGVGAVYVRKNQKVAELAPTILEKMNWPAGTEFMLFEEIKHNMIDVMKPKQTFQQSE
IQDGDIITFQRTVKESDLPSAALYTDARQYYDYLLNRINITFAPIKATDGDEFTLTLSRK
MTYDQFSKKVGEHLNVESTHLRFAPVLASTGKPKQFIKRNPNQANQTLYHILSGQVSGYG
YSMHRQDALYYEVLETSLSDYESKTTLKVTLLTEGIVKEQLVEVLVPRDGTFADLLAGLQ
KKANLEDDVVREMRIFEAHSGKIYKEYQEDAKIAGINEYVTLYAERIPEEELQMQDSERT
INAFSFDREPSRPHGIPFKFVMKPGEIFKETKERLSKRTGIKGKQFEKIKFAVVPKSLYS
NPRYLDDDDILSDIVGESDDLLGLDHVNKSRSFWSRSESFFIR
NT seq 3372 nt NT seq  +upstreamnt  +downstreamnt
atggacaacgttgcggataatgagatgctcgtcgatgaatatgagcagtatcacaatgac
aggacagatgatgtcgtggtttctcgctccggatcagaggagccggaaccagagcccctt
gcggatgactttccggcaatgatggcgcgcatacttcctaaggatccggacctggaaacc
gcggacgaggcataccacacatggcacatccaggattggcggaagttgaaaaagaaggaa
catggaccagtattccagtgtgggggattcccatggcgggttcttttcttcccttacggt
aatcatgtcgattatgcgtcgttctatttggagcatgcctgggaaaaagagcctccggaa
aactggtatgcgtgcgtccagtttgctcttgtattatggaacgtcaatgacccatcaatt
tacgtatctcatgtcgctacgcaccgtttcaacgccgacgagggcgattggggctttacc
aggttctgtgagctgcgcaggcttttcaacatgccgtgggaaggccgtggagtccccctg
gtgcagaatgatgaagctaaagtcactgcctacgtgcgtgttgtgaaggacccgacaggg
gtactctggcacagttttcaaaattacgactcgaagaaggagactggcatggtggggttg
aaaaaccagggcgcaacgtgctacctcaactccctgctgcaatccttgtatttcacaaat
gctttccgcaaggccgtgtaccaaattcccacggaggcagaagcgacgcgagagaacagt
gcctggacactccagaggctcttctacaatcttcaaacgagcgaaagctctgtctcgaca
acagagttgaccgcatcatttggctgggaatcgcggcaaatcttcgaacagcaagatgtc
caggaactttccagaaagcttatggaaagattggaagagaagatgaaagcgacaccagta
gagaaagcattgcctgagcttttcgtcgggaagacgaagacttacatttcatgtatcaac
gtcgactacgaatcgtcgcgtgttgaagacttttgggatatccagctcaatgtcagaggc
aacaagacactcgacgacagtttcaaggactacattcaggtggaaacccttgagggcgag
aacaagtacgatgcaggctctccctacggcttgcaagacgccaagaaaggtgtcatcttc
gagagcttccctcctgtgcttcatctgcacctgaaacgtttcgaatatgacattaatcgc
gatgcaatgatgaagatcaatgaccgtcacgctttccccatggaattcgacgcgactcca
tatctatccgatgctgccgacaaatcagaaccgtgtatttatcagctgcacggtgttcta
gttcacagcggtgatctgaacgcaggccattactacgcattcttgaagcctaccaaggac
ggccattggtacaaattcgatgacgaccgtgtgacccgggccactgacaaggaggtactt
gaggagaactatggtggtgaatatgaactatccaatggtgcggccggcgtccggcaacca
catacacggggtctgtcgaccaaacggtcaatgaatgcctacatgttggtctatattcgg
aaaacacgcctggatgatgtccttctgccgattacaaaggatgatattccttctcacatt
gaaaagcgtttagtagaggagcgggcagagcttctccgcagaaagaaggagagagaagag
gctcacctgtatatcaatgtgggagttctatcggacgagtcgtacaagtcacatcatgga
ttcgatctgacgagcacggacctaccggccggcgatcctgccctgccgaaacagtatagg
attcttcgggctaagaaggttggcgagttcgtagagcagcttgcggaagaacggggtctg
aacgcaaaccaaatcaggctgtgggtgatggtgaaccgtcaaaacaagacgactcgcccg
gaccaagccatcaaagaccgagaaatgacggtggaagaggcctacaacagatttgggacc
aaagggaacccgttcaaagtctggatggaagttgggcaaccatctgcggatggaaccatt
tcgtggcctgacagcagtacttctgttctcgtctttttgaagaactttgacgtcccatcc
cagactctttctggagtcggtgccgtatacgtccgcaagaatcagaaagtcgcagaactc
gccccgacaattctcgagaaaatgaactggcctgccgggacagagttcatgctttttgag
gaaatcaagcacaacatgatcgatgtgatgaagccgaagcagactttccagcagtctgaa
attcaagacggcgacataatcacgttccaacgcacagtcaaagaatccgacttaccatcc
gctgcactatacacggatgcaaggcagtactatgactacttgttgaacaggataaatatc
acattcgctcccatcaaagcgactgatggcgacgagttcactctcactctgagccgaaag
atgacatacgatcagttctcgaagaaggtcggcgagcaccttaacgtggaatccactcac
ctgcgtttcgcccctgttcttgctagtaccggaaagcccaagcagttcattaaacgcaat
cctaaccaggccaaccaaacgctgtatcacatccttagtgggcaggtcagtggctacggt
tatagtatgcatcgccaagatgcactatactacgaagtccttgagactagtctcagtgac
tacgagtcgaaaactacactgaaagtaacattactcaccgagggcattgtgaaagagcaa
ttggttgaagtcctagtgcctcgggacggcaccttcgcggatcttctggcgggtctgcag
aaaaaggcaaaccttgaagatgatgtggttcgagaaatgcggatcttcgaggcccacagc
ggcaaaatatacaaggagtaccaagaagatgctaagatcgctggcatcaatgagtacgtg
actttatacgctgagaggatacccgaggaagagctccagatgcaggacagcgaacggaca
atcaacgcattcagctttgaccgagagccgagcaggccgcatggtatccctttcaagttt
gtcatgaaacctggcgagatcttcaaggaaacaaaagagagactctccaaacgaaccggc
atcaagggcaaacaatttgagaagatcaaatttgctgtcgttcccaagtctttgtattct
aacccgcggtatcttgatgatgatgatatcctttccgacattgttggcgaatccgacgat
ctgctgggactggaccatgtaaataaaagccggagcttttggagcaggagcgagtctttt
ttcattcgatag

DBGET integrated database retrieval system