KEGG   Neosartorya fischeri: NFIA_038940Help
Entry
NFIA_038940       CDS       T01070                                 

Definition
translation initiation factor eIF4E3, putative
Orthology
K03259  
translation initiation factor 4E
Organism
nfi  Neosartorya fischeri
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    NFIA_038940
Translation factors [BR:nfi03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    NFIA_038940
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 347 aa AA seqDB search
MDNANLWTRRANSAKLSLSMTGTDGKDGGAKVDLPRGHTSKRFGPDSSHGGRSNPFNALS
PLSGGVSSPSTNASSAFGLGSGAFASFGTPKTPGTNASDLNSSKALGEKRETASEQDSAT
EVKAKASASSLTGPKEHALKSTWVIWYRPPTPKYSDYEKSTIPLASISSVESFWSIYTHL
KRPSLLPTVSDYHIFKKGIRPVWEDDANKKGGKWIVRLKKGVADRYWEDLLLAMIGDQFA
EASDEVCGAVLSVRSGEDVLSVWTRIDGGRNIKIRETIKRLLAFPADTNIVWKSHDDSIA
QRSAIDQARQEKAAGNAGHHHHHLAGDRRRPTVNDESMGDKGKAAAS
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggataatgcaaacttgtggactcgcagggccaattccgccaaattgtctctgtccatg
acaggaaccgacggaaaggacggtggcgcgaaagtcgatcttccccgcggtcacacatca
aagcgtttcggcccggatagctcgcacggcggtcgatcgaatcccttcaatgcattatcc
cccctctcgggtggcgtgtcttctccttccacgaacgcatcctccgcattcggcttgggt
tcgggcgcattcgcgtcctttggtactcccaagacgcctggcaccaatgcgtcagacctg
aattcgtccaaagcgctgggggagaagcgagagacggcttcggagcaggattcggcaacg
gaagtcaaggccaaggcttcagcctcctctttgactggcccgaaggagcatgctctgaag
tctacgtgggtgatctggtaccgtcccccgacacccaagtactctgactatgagaagtca
accattccccttgcgtctatatcctcggtcgagagtttctggtcgatatacacacatctc
aagcgcccatcgctcctccccaccgtctctgactatcacattttcaagaaaggcatccgt
cctgtatgggaggacgatgccaacaagaagggtggaaagtggattgttcggctgaagaag
ggagttgctgaccggtattgggaggatcttttgttggccatgattggtgaccagttcgcg
gaggctagcgatgaggtctgtggcgctgttctcagtgtaaggagcggagaggatgtgttg
agtgtctggactcggattgacggtgggcgtaacatcaagatcagggagacgatcaagcgg
cttcttgccttccctgccgacaccaacattgtatggaagagccacgacgacagtattgct
cagcgctccgcaattgaccaggctcgccaggagaaggcggccggaaacgcgggccatcat
caccaccacctcgcaggggaccgacgaagacctacagtgaatgacgagtccatgggagat
aaaggaaaagcggcggcgtcttga

DBGET integrated database retrieval system