KEGG   Neosartorya fischeri: NFIA_038970Help
Entry
NFIA_038970       CDS       T01070                                 

Definition
GTP cyclohydrolase I, putative
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
nfi  Neosartorya fischeri
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NFIA_038970
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     NFIA_038970
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 334 aa AA seqDB search
MSSGSPPPGPKPKSAIPPHLLNGSSPLHPSNTTGGRDARERESLNSSIRSSFAPRIPAEF
NLPETETHHVSDAADTYNGPVRNSGVARPTLSDPPRDPRDEGGALTPPASASRPSSPYTS
NPPIDFDGLSWPCPGTRARLESTPEQTEERIQKLAGAVRTIFECIGEDPEREGLRETPER
YAKAMLYFTKGYEENVRDLVNGAVFHEDHDELVIVKDIEVFSLCEHHMVPFTGKMHIGYI
PDRRVLGLSKLARLAEMFSRRLQVQERLTKQVALAISEVLKPRGVGVVMESSHLCMVMRG
VQKTSSTTTTSCMLGCMRSSAKTREEFLTLLNRK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgagctccggatctcctcctccaggcccaaagcctaagtctgctattccacctcacctt
ttgaatggtagctctcctcttcacccttccaataccactggcggtcgtgacgctcgtgag
cgcgagagtctaaactcatccatccgctcctcttttgctcctcgcatccccgctgagttc
aacttgccggaaacagaaactcatcatgtcagtgatgccgccgatacctataatggacct
gttcggaattcgggcgttgccaggcctaccttgagcgatcccccgcgagaccccagagat
gagggcggtgctttaacccccccggcaagtgccagtcgaccatctagcccgtacacttcg
aatcctccaattgactttgacgggttgagttggccttgccccggcacgagagcacgattg
gaatctactcctgagcaaactgaagagcgcattcagaaacttgcaggtgctgtaagaacc
atatttgaatgcattggagaggacccggagagagaaggtctgcgggagacccccgagaga
tatgccaaggctatgctctacttcaccaaaggctacgaagaaaatgtcagggatcttgtc
aatggagcagttttccatgaggaccacgatgagctggtcattgtcaaggatattgaggtg
ttttccctctgcgaacatcacatggtaccttttactggaaagatgcatattggatacatc
cctgaccgtcgggtgcttggtctttctaagctagcgcgactggcggagatgttctcccga
agacttcaggtgcaagaacgtctcaccaagcaagttgccctcgctatttcggaggttctg
aaaccccgcggcgttggtgtcgtcatggaatcttctcacctttgtatggtgatgcgtggt
gtacagaaaaccagcagcaccacgacaaccagctgtatgcttggttgcatgcggtccagc
gcgaagacccgggaagagttcttgacgctcctcaatagaaagtga

DBGET integrated database retrieval system