KEGG   Neosartorya fischeri: NFIA_040760Help
Entry
NFIA_040760       CDS       T01070                                 

Definition
lysophospholipase
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
nfi  Neosartorya fischeri
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NFIA_040760
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     NFIA_040760
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 543 aa AA seqDB search
MYGNRVELTRVTLFYLSFLIVLLLPLSLANGALLATALVNRALPNAPNGYTPEGETCPSN
RPSIRNATALSNAETSWLKARRNNTRDALKAFLSRVDLGSFNGSAYIANHSANASALPNI
GIAVSGGGYRALMNGGGALQAFDNRTTNSTHSGQLGGILQSATYLSGLSGGSWGRSLSYQ
LINAPEGGVSYTWSSIALSKDFQAGTMPMPLVIADGRAPGETVVPTNTTVFEFNPWEFGS
WDESLSAFVSLEFLGSNFSKGTLATGEKCVRGFDNAGFIMGTSSSLFNQAFLHMNDTDAP
PAVKDSISAILGGIGSENNDIAVYKPNPFYRYASQSKYTTSPSLTLVDGGEDLQNIPLDP
LLQPQRHVDVILALDSSADTTTRWPNGTSMVATYERNVDSSETNSGLPFPSVPDQNTFVN
LGLNNRPTFFGCNSSNMTGSPLVVYIPNAPYIYPSNVSTFDLQYNTSERNAIIENGYDVA
TLGNGTVDSNWPSCLACAILSRSFERTNTTVPEICSTCFKKYCWNGTVNATTPGDYYPTL
KLQ
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgtatgggaatcgtgttgaattgaccagggttaccctgttttatttatccttcctcata
gttctactattacctctctcccttgccaatggagctttattagctactgcccttgtcaat
cgtgcgttacctaatgcacccaacggatacacccctgaaggcgagacctgcccttcgaat
cggccatctatccgcaatgccactgccctatcgaacgccgagacctcctggctgaaagca
cgaagaaacaataccagagacgccctgaaagcgtttctcagccgagtcgacctcggttct
ttcaatgggtcggcctatattgctaatcattcggctaatgcatctgccttgcccaatatt
ggaattgcagtgtctggcggtggctatcgagccttgatgaatggtggaggtgcactgcag
gcgtttgataatcggaccacgaactcaactcacagcggccaactgggaggtatcctacag
tcggctacttacctttcggggctcagtggtggaagttggggacgttctctctcttaccaa
ctcatcaatgcgcctgaaggtggtgtcagttatacctggtcgtcgattgctctaagcaag
gatttccaagctgggacgatgcctatgcccttggtcatcgctgatggtcgagctccgggc
gagaccgtagtacccacgaacactacggtcttcgagtttaacccttgggaatttggaagc
tgggacgaatctctatccgccttcgtttccctagaattcctgggatcgaacttttcgaaa
ggaacactagcgacaggtgaaaagtgtgttcgaggattcgataacgcagggttcatcatg
ggcacgtcgtcatccctgttcaatcaagcattcctgcatatgaacgataccgacgcgcca
ccagccgtgaaggactccatcagtgcgattctggggggtatcgggtccgagaacaatgat
atcgccgtctacaagcctaaccctttctatcgctatgcgagccagtccaaatatacaaca
tcgccctcattgaccttggtggatggaggagaagatctccagaacatcccgctcgatccc
cttcttcagccccaacgtcacgttgacgtgattttggctctcgactcgtcagcggacacg
actacaaggtggcccaatgggacatccatggtcgccacatatgagcgaaacgtagactca
tcagaaacgaacagtggtctgccttttccctctgtgcctgatcaaaacacattcgtcaac
cttggtttgaacaaccgcccgacattctttggctgcaatagttcaaacatgactggctct
ccgcttgtcgtttatattccgaacgccccgtatatatacccgtccaacgtgtccacgttc
gatctgcaatacaatactagtgaacgcaacgccatcattgagaatggctacgatgtggca
acactggggaatgggacagtggactccaactggccgtcttgtcttgcttgcgctatattg
agtcggagttttgaacgcacaaatacgacagtcccggagatctgctcgacttgtttcaag
aagtactgttggaatggtaccgtaaatgcaactactcctggggattattatccgacgttg
aaactgcagtag

DBGET integrated database retrieval system