KEGG   Neosartorya fischeri: NFIA_044540Help
Entry
NFIA_044540       CDS       T01070                                 

Definition
6-phosphofructokinase alpha subunit
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
nfi  Neosartorya fischeri
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NFIA_044540
   01230 Biosynthesis of amino acids
    NFIA_044540
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NFIA_044540
   00030 Pentose phosphate pathway
    NFIA_044540
   00051 Fructose and mannose metabolism
    NFIA_044540
   00052 Galactose metabolism
    NFIA_044540
  Energy metabolism
   00680 Methane metabolism
    NFIA_044540
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    NFIA_044540
Enzymes [BR:nfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     NFIA_044540
Protein phosphatases and associated proteins [BR:nfi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     NFIA_044540
Messenger RNA biogenesis [BR:nfi03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     NFIA_044540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 791 aa AA seqDB search
MSSTQAPVEPPKRRRIGVLTSGGDAPGMNGAVRAVVRMAIYSDCEAYAVFEGYEGLVHGG
HMIRQLHWEDVRGWLSKGGTLIGSARSMAFRERAGRLKAAKNMVLRGIDALVVCGGDGSL
TGADVFRSEWPGLLEELVRNGELTEEQIKPYKVLNIVGLVGSIDNDMSGTDATIGCYSSL
TRICDAVDDVFDTAFSHQRGFVIEVMGRHCGWLALMSAISTGADWLFIPEMPPRDGWEDD
MCSIITKNRKERGKRRTIVIVAEGAQDRSLNKISSSTIKDILTQRLGLDTRVTVLGHTQR
GGAACAYDRWLSTLQGVEAVRAVLDMKPDSPSPVITIRENKIMRTPLMDAVQETKHVAKL
IHDKDFEAAMRMRDAEFKEYHFAYRNTATPDHPKMILPEDKRMRIAIIHVGAPAGGMNQA
TRAAVGYCLTRGHTPLAIHNGFPGLCRHHDDQPVGSVREVKWLESDAWVNEGGSDIGTNR
SLPSEDFETTAMCFEKYKFDALFVVGGFEAFTAVSQLRQARDKYPAFKIPMVVLPATISN
NVPGTEYSLGSDTCLNTLIDFCDAIRQSASSSRRRVFVIETQGGKSGYIATTAGLAVGAT
AVYIPEEGIDIKMLSNDIDFLRENFARDKGANRAGKLILRNECASSTYTTQVIADIFKEE
AKGRFESRSAVPGHFQQGGKPSPMDRIRALRMAVKCMLHLENYAGKSRDEIAADPMSAAV
IGIKGSQVLFSAMGGEDGLEATETDWARRRPKTEFWLELQNYVNVLSGRAAAGKPMWSCY
ESIEPSAPTSP
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgagctcaacacaagcgcccgtcgagccgcccaagagacgccgcattggtgtcctcacc
tcgggtggtgatgcccccggtatgaacggagccgtgcgggccgtcgtccgtatggccatt
tactccgactgcgaagcgtacgccgtgttcgaaggttatgagggattggttcatggtggt
catatgattcgtcagctgcactgggaagatgtccgtggctggctgtccaagggtggtaca
ctgatcggatctgctcggagcatggctttccgcgaacgcgctggacgtctcaaggctgct
aagaacatggtgctccgcggtatcgatgctctggttgtctgcggtggtgacggaagtttg
accggagccgacgtcttccgttcggaatggcccggtttgctggaggagctggtcaggaat
ggtgaattgactgaggaacagatcaagccgtacaaggttttgaacattgttggcttggtg
ggttccattgacaacgacatgtccggcactgacgccaccatcggctgctattcctctctg
acacgaatctgcgatgccgtcgacgacgttttcgatactgcgttttcccaccagcgaggt
ttcgttatcgaggttatggggcgacactgcggttggttggctttgatgtccgcgatcagt
accggcgcggactggttgttcattccggagatgcctcctcgtgatgggtgggaggatgac
atgtgctcgatcatcaccaagaaccgcaaagaacgtggcaagcgtcgtactatcgttatc
gtcgccgaaggtgctcaggaccgcagtctcaacaagatttccagctcaacgatcaaagac
attctcacacagcgactcgggctggatactagagttactgtgctgggacacactcagaga
ggaggagcagcatgcgcatatgaccggtggctgtccaccttgcagggtgttgaagccgtc
cgggccgttctggatatgaagccggactcgccatcgccagtcattaccattcgtgagaac
aagatcatgcggacaccgctgatggacgcagtgcaagaaaccaagcatgtagcgaagctc
atccatgacaaggactttgaggcagcgatgagaatgcgggatgccgaattcaaagaatac
cactttgcctatcgcaacactgccacacctgatcatcccaagatgatcctccctgaagac
aagagaatgagaattgccatcatccacgtcggtgccccggccggaggcatgaaccaagcc
acccgcgccgctgtcggttactgcctcactcgtggacacaccccccttgcgattcacaac
ggtttccccggcctttgccgtcaccacgatgatcagcctgtgggctctgttcgtgaagtc
aagtggctggagtccgatgcctgggttaacgagggtggatcggatattggaacaaaccgt
agcctgccgtccgaggatttcgagaccactgcaatgtgcttcgagaagtacaagtttgac
gcactgttcgtggttggtggtttcgaagccttcacggcagtcagccagctccgtcaggcc
cgcgataaatatcctgctttcaagatccccatggttgtgttgcccgctacgatttcgaac
aatgtgcctggaaccgagtactcgctgggaagcgacacctgtctcaacaccttgattgat
ttctgcgacgccatccgccagtcggcgtcgtcctctcgtcgtcgtgtcttcgtcatcgag
acacaaggtggtaagtcgggctacatcgccactaccgctggtctcgccgtcggcgctaca
gccgtgtacattcccgaagagggcatagacatcaagatgctctcgaatgacattgacttc
ctgcgcgagaactttgcccgtgacaagggagccaaccgtgccggaaagctcatcctgcgc
aacgaatgtgcctccagcacctataccacacaggtcatcgccgacatcttcaaggaggag
gccaagggtcggttcgagtctcgctcggcggtccctggccacttccagcaaggaggtaag
ccatcgccgatggaccgtatccgcgctctccggatggcggtcaagtgtatgctgcatctc
gaaaactacgcaggcaagtcgcgcgacgagattgcggcggacccgatgtcggcggcggtc
atcggtatcaagggctcgcaggtgttgttctccgccatgggcggcgaggacggtctggag
gcgacggagacggattgggcacgccggcgtcccaagacggagttctggctggagcttcag
aactatgtcaacgtcctgtctggccgtgctgctgcgggaaagcccatgtggtcatgctat
gagtccattgaaccttcggcgcccacttcaccttag

DBGET integrated database retrieval system