KEGG   Neosartorya fischeri: NFIA_045020Help
Entry
NFIA_045020       CDS       T01070                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
nfi  Neosartorya fischeri
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    NFIA_045020
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NFIA_045020
  Lipid metabolism
   00071 Fatty acid degradation
    NFIA_045020
  Amino acid metabolism
   00350 Tyrosine metabolism
    NFIA_045020
Enzymes [BR:nfi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NFIA_045020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 361 aa AA seqDB search
MDSKIYDIPTHCKAGVVVNEGPDFQVKVEMVPVPEPGPDDILIRLNVTGLCSSDIHMMKN
DLGTPPMSFFGVRSPGHEGAGIVVKTGANVRNFKVGDRAGIKPLTDTCGSCELCWDDKET
YCRTAVHTGLMTAGTYQQYIVSPARYASPIPDGVPDEIAAPIMCSASTIYRSLVESGLRP
GHWAVFPGGGGGVGIQGVQLARAMGMRPIVVDTGPAKRALALEMGAEAFVDFAETEDTTA
AVVAAADGIGAHGVFVTAPAAYRTALSFVGDRVGAVVMCIGLAPAKTMVVGDDPNRFIFK
NLTIKGTLVGSRKDTAAALDFARRGMLKQICEVYPIDRLPEAVEKLRRGEVAGRIVVDFD
Q
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggactcaaaaatctacgacatcccgacccactgcaaagccggggtggtcgtcaatgaa
ggccccgactttcaagtcaaggtggaaatggtccccgtgccagaaccaggccccgacgac
atcctcatccgcctcaacgtcaccggcctctgctcctccgacatccacatgatgaagaac
gacctcggcacgccgcccatgtcgttctttggcgtccggtcacccggccacgaaggcgcc
ggtatcgtcgtcaagacgggcgccaacgtccggaacttcaaggtcggtgatcgcgcgggc
atcaagccgctgacagatacatgcgggtcgtgcgagctgtgctgggacgacaaggagaca
tactgccggacggccgtgcatacggggttgatgaccgcaggcacataccagcaatacatc
gtctcgcctgcccgctacgcctcccccatccccgatggcgtccccgacgaaatcgccgcc
ccgatcatgtgtagtgcttcgaccatctatcgatccttggtggagtccgggctgcgaccg
ggccactgggctgttttccctggcgggggcggcggcgtcgggatccagggtgtgcagctg
gcgagggcgatggggatgcgaccgatcgtggtggacacggggccagcgaagcgcgcgctg
gcgttggagatgggcgcggaggcgtttgtcgatttcgccgagacggaagacaccactgct
gcggtggtggctgccgcggatgggatcggcgcgcacggggtgtttgtcacggcgccggcg
gcttatcggactgcgctgtcgtttgtgggagaccgggtcggggcggttgtgatgtgcatt
ggactggcgccggccaagacgatggtcgttggcgatgatcccaaccggttcatttttaag
aacctgacgatcaaggggaccctggtggggagccgcaaggatacagcggcggcactggac
tttgcgcgacgagggatgctgaagcagatttgtgaggtgtatcccatcgatcggttaccg
gaggctgttgaaaagctgcgaaggggagaggttgcgggcagaatcgtggtcgattttgac
cagtag

DBGET integrated database retrieval system